ÿØÿà JFIF    ÿÛ „ ( %!1!%*+...983,7(-.- LC_MESSAGES/libuser.mo000064400000041311152343356400010340 0ustar00L | 59Me*$ "";"^ <U/t)'-F_{*)(G^.z((.$G l!v "#!#&$J#o. +<%Kq    *8 > HU-l#,$,C"p #?P'd!  3;X"m!## # 1=Pb s$8(#*L*w)*)!81T! )' &Q x !     &!(:!$c!!!!!!'!&"';" c"3"!""" ##(#"<#_#}# # ## # $"@$c$|$$$$$%$#% 6%W%'m%%%% %-%&$&"7&Z&$z&&&&(:())?)[)q)));))* ,*M* l*+*+*6*1+N+_+$v++J++4,4T,2,,,,-,-K-&f--4-1-6.H.g.5.0.6.!/1@/%r/ /./ //#/$0"C0$f0%0'000)1 ;1I1\1t11/111122;2P2e2w22 2222212)3E3=^303-363.24a44 444440515H5!a5 5!5&5'56+6G6N6!m6)6(6*6- 7";7^7 v7 7777778$)8!N8=p8%8$8'8*!9&L9*s999<9 :&:D:+c:%::+:9:5;#T;%x;;;;&;- <:;<v<<<*</<;!=/]=$=?=&=>1>O>a>{>!>>">#>!?#6? Z?${?"????@"@B@#_@-@-@@0@&!A%HA nAyA9AAA&A1&B'XB&B!B]N-MP<6Vra^RJyjzhOwK}8 3UqWB|i')!ImF>1&540Yct~{Ze2lH k*%Cb7"GTD`Eo=S@f(\Lp_+; s#Xu$v[Ag/9Qx?n:,. d%s did not have a gid number. %s is not authorized to change the finger info of %s Account Expires: %s Account creation failed: %s. Account is locked. Account is not locked. Authentication failed for %s. Both -L and -U specified. Can't set default context for /etc/passwd Changing finger information for %s. Changing password for %s. Changing shell for %s. Copying user structure: Cyrus SASL error creating user: %sCyrus SASL error removing user: %sDefault user attribute names: Default user object classes: E-Mail AddressEntry not found. Error changing owner of `%s': %sError creating %s: %s. Error creating account for `%s': line improperly formatted. Error creating group `%s': %s Error creating group for `%s' with GID %jd: %s Error creating home directory for %s: %s Error creating user account for %s: %s Error initializing %s: %s Error initializing %s: %s. Error initializing PAM. Error looking up %s: %s Error moving %s to %s: %s. Error opening `%s': %s. Error parsing arguments: %s. Error reading `%s': %sError setting initial password for %s: %s Error setting password for group %s: %s. Error setting password for user %s: %s. Error writing `%s': %sFailed to drop privileges. Failed to modify aging information for %s: %s Failed to set password for group %s: %s Failed to set password for user %s: %s. Finger information changed. Finger information not changed: input error. Finger information not changed: %s. Full NameGetting default user attributes: Given NameGroup %jd does not exist Group %s could not be deleted: %s Group %s could not be deleted: %s. Group %s could not be locked: %s Group %s could not be modified: %s Group %s could not be modified: %s. Group %s could not be unlocked: %s Group %s does not exist. Group creation failed: %s Group with GID %jd did not have a group name. Home PhoneInactive: %ld Internal PAM error `%s'. Internal error. Invalid ID %s Invalid default value of field %s: %sInvalid group ID %s Invalid user ID %s LDAP Bind DNLDAP Bind PasswordLDAP SASL Authorization UserLDAP SASL UserLDAP Search Base DNLDAP Server NameLast Change: %s Maximum: %ld Minimum: %ld NeverNew ShellNew passwordNew password (confirm)No group name specified, no name for gid %d. No group name specified, using %s. No group name specified. No group with GID %jd exists, not removing. No new home directory for %s. No old home directory for %s. No user name specified, no name for uid %d. No user name specified, using %s. No user name specified. OfficeOffice PhonePassword Expires: %s Password Inactive: %s Password change canceled. Password changed. Passwords do not match, try again. Prompts failed. Prompts succeeded. Refusing to create account with UID 0. Searching for group named %s. Searching for group with ID %jd. Searching for user named %s. Searching for user with ID %jd. Shell changed. Shell not changed: %s SurnameUnknown user authenticated. Unknown user contextUser %s could not be deleted: %s. User %s could not be locked: %s. User %s could not be modified: %s. User %s could not be unlocked: %s. User %s does not exist. User mismatch. Warning: %ld [OPTION...][OPTION...] [user][OPTION...] group[OPTION...] useraccess deniedbad user/group idbad user/group nameconfiguration file `%s' is too largecould not bind to LDAP servercould not bind to LDAP server, first attempt as `%s': %scould not negotiate TLS with LDAP servercould not open configuration file `%s': %scould not read configuration file `%s': %scould not set LDAP protocol to version %dcould not stat configuration file `%s': %scouldn't get security context of `%s': %scouldn't open `%s': %scouldn't read from `%s': %scouldn't set default security context to `%s': %scouldn't stat `%s': %scouldn't write to `%s': %sdata not found in fileentity object has no %s attributeentry already present in fileerror creating `%s': %serror creating a LDAP directory entry: %serror creating home directory for usererror encrypting passworderror initializing Cyrus SASL: %serror initializing ldap libraryerror loading moduleerror locking fileerror locking file: %serror manipulating terminal attributeserror modifying LDAP directory entry: %serror moving home directory for usererror opening fileerror reading fileerror reading from terminalerror reading terminal attributeserror removing LDAP directory entry: %serror removing home directory for usererror renaming LDAP directory entry: %serror resolving symbol in moduleerror setting password in LDAP directory for %s: %serror setting terminal attributeserror statting fileerror writing to filegeneric errorgroup %jd has no namegroup %s has no GIDgroup has neither a name nor a GIDinternal initialization errorlibrary/module version mismatchmodule `%s' does not define `%s'module disabled by configurationmodule version mismatch in `%s'name contains control charactersname contains invalid char `%c'name contains non-ASCII charactersname contains whitespacename is not setname is too long (%zu > %d)name is too shortname starts with a hyphenno `%s' attribute foundno initialization function %s in `%s'no shadow file present -- disablingno such object in LDAP directorynot enough privilegesnot executing with superuser privilegesobject had no %s attributeobject has no %s attributesuccessunknown errorunlocking would make the password field emptyuser %jd has no nameuser %s has no UIDuser has neither a name nor an UIDuser object had no %s attributeuser object was created with no `%s'user/group id in useuser/group name in useProject-Id-Version: libuser 0.60 Report-Msgid-Bugs-To: http://bugzilla.redhat.com/bugzilla/ POT-Creation-Date: 2015-07-23 21:16+0200 PO-Revision-Date: 2013-04-29 04:37-0400 Last-Translator: Miloslav Trmač Language-Team: Welsh (http://www.transifex.com/projects/p/fedora/language/cy/) Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; X-Generator: Zanata 3.6.2 Nid oedd rhif gid gyda %s. Does gan %s ddim caniatâd i newid gwybodaeth 'finger' %s Cyfrif yn Darfod: %s Methodd creu'r cyfrif: %s. Mae'r cyfrif ar glo. Nid yw'r cyfrif ar glo. Methodd dilysiant ar gyfer %s. Penodwyd -L ac -U ill dau. Methu gosod y cyd-destun rhagosodedig ar gyfer /etc/passwd Yn newid gwybodaeth byseddu ar gyfer %s. Yn newid cyfrinair ar gyfer %s. Yn newid plisgyn ar gyfer %s. Yn copïo strwythur defnyddiwr: Gwall SASL Cyrus wrth greu'r defnyddiwr: %sGwall SASL Cyrus wrth greu'r defnyddiwr: %sEnwau priodoleddau gwrthrych defnyddiwr rhagosodedig: Dosbarthiadau gwrthrych defnyddiwr rhagosodedig: Cyfeiriad E-BostCofnod heb ei ganfod. Gwall wrth newid perchennog `%s': %sGwall wrth greu %s: %s. Gwall wrth greu cyfrif ar gyfer `%s': llinell wedi'i fformadu'n anghywir. Gwall wrth greu grŵp `%s': %s Gwall wrth greu grŵp ar gyfer `%s' â GID %jd: %s. Gwall wrth greu cyfeiriadur cartref ar gyfer %s: %s Gwall wrth greu cyfrif defnyddiwr ar gyfer %s: %s Gwall wrth ymgychwyn %s: %s Gwall wrth ymgychwyn %s: %s. Gwall wrth ymgychwyn PAM. Gwall wrth waredu %s: %s Gwall wrth symud %s i %s: %s. Gwall wrth agor `%s': %s. Gwall wrth ddyrannu ymresymiadau: %s. Gwall wrth ddarllen `%s': %sGwall wrth osod cyfrinair dechreuol ar gyfer %s: %s Gwall wrth osod cyfrinair ar gyfer grŵp %s: %s. Gwall wrth osod cyfrinair ar gyfer defnyddiwr %s: %s. Gwall wrth ysgrifennu `%s': %sMethwyd gollwng breintiau. Methwyd addasu'r wybodaeth heneiddio ar gyfer %s: %s Methwyd gosod cyfrinair ar gyfer y grŵp %s: %s Methwyd gosod cyfrinair ar gyfer y defnyddiwr %s: %s. Newidiwyd gwybodaeth fyseddu. Ni newidiwyd gwybodaeth fyseddu: gwall mewnbwn. Ni newidiwyd gwybodaeth fyseddu: %s. Enw LlawnYn nôl priodoleddau defnyddiwr rhagosodedig: Enw CyntafNid yw'r grŵp %jd yn bodoli Nid oedd modd dileu'r grŵp %s: %s Nid oedd modd dileu'r grŵp %s: %s. Nid oedd modd cloi'r grŵp %s: %s Nid oedd modd addasu'r grŵp %s: %s Nid oedd modd addasu'r grŵp %s: %s. Nid oedd modd datgloi’r grŵp %s: %s Nid yw'r grŵp %s yn bodoli. Methwyd creu'r grŵp: %s Doedd gan y grŵp â'r GID %jd ddim enw. Ffôn CartrefAnweithredol: %ld Gwall PAM mewnol `%s'. Gwall mewnol. ID annilys %s Annilys yw'r gwerth rhagosodiedig o maes %s: %s%s yn ID grŵp annilys %s yn ID defnyddiwr annilys EP Rhwymo LDAPCyfrinair Rhwymo LDAPDefnyddiwr Awdurdodi SASL LDAPDefnyddiwr SASL LDAPEP Sail Chwilio LDAPEnw Gweinydd LDAPNewid Diwethaf: %s Uchafswm: %ld Isafswm: %ld BythPlisgyn NewyddCyfrinair newyddCyfrinair newydd (gwiriwch)Ni phenodwyd enw grŵp, dim enw ar gyfer gid %d. Ni phenodwyd enw grŵp, yn defnyddio %s. Ni phenodwyd enw grŵp. Nid oes grŵp â'r GID %jd yn bodoli, felly gwaredir e ddim. Nid oes cyfeiriadur cartref newydd ar gyfer %s. Nid oes hen gyfeiriadur cartref ar gyfer %s. Ni phenodwyd enw defnyddiwr, dim enw ar gyfer uid %d. Ni phenodwyd enw defnyddiwr, yn defnyddio %s. Ni phenodwyd enw defnyddiwr. SwyddfaFfôn SwyddfaCyfrinair yn Darfod: %s Cyfrinair Anweithredol: %s Diddymwyd newid y cyfrinair. Newidiwyd y cyfrinair. Nid yw'r cyfrineiriau'n cydweddu, ceisiwch eto. Promptiau wedi methu. Promptiau wedi llwyddo. Yn gwrthod creu cyfrif â UID 0. Yn chwilio am grŵp o'r enw %s. Yn chwilio am grŵp â'r ID %jd. Yn chwilio am ddefnyddiwr o'r enw %s. Yn chwilio am ddefnyddiwr â'r ID %jd. Newidiwyd y plisgyn. Ni newidiwyd y plisgyn: %s CyfenwDilyswyd defnyddiwr anhysbys. Cyd-destun defnyddiwr yn anhysbysNid oedd modd dileu'r defnyddiwr %s: %s. Nid oedd modd cloi'r defnyddiwr %s: %s. Nid oedd modd addasu'r defnyddiwr %s: %s. Nid oedd modd datgloi’r defnyddiwr %s: %s. Nid yw'r defnyddiwr %s yn bodoli. Defnyddiwr anghydwedd. Rhybudd: %ld {DEWISIAD...][DEWISIAD...] [defnyddiwr][DEWISIAD...] grŵp[DEWISIAD...] defnyddiwrgwrthodwyd cyrchiaddynodiad defnyddiwr/grŵp gwaelenw defnyddiwr/grŵp gwaelMae ffeil gyfluniad '%s' yn rhy fawrmethwyd rhwymo â'r gweinydd LDAPmethwyd rhwymo â'r gweinydd LDAP, cynnig cyntaf fel `%s': %smethwyd trafod TLS â'r gweinydd LDAPmethwyd agor ffeil gyflunio `%s': %smethwyd darllen ffeil gyflunio `%s': %smethwyd gosod y protocol LDAP i fersiwn %dmethwyd statio ffeil gyflunio `%s': %smethwyd cael cyd-destun diogelwch `%s': %smethwyd agor: `%s': %smethwyd darllen o `%s': %smethwyd gosod y cyd-destun diogelwch rhagosodedig i `%s': %smethwyd statio: `%s': %smethwyd ysgrifennu i `%s': %sni chanfuwyd y data yn y ffeilnid oes gan y gwrthrych endid briodoledd %scofnod eisoes yn bresennol yn y ffeilgwall wrth greu: `%s': %sgwall wrth greu cofnod cyfeiriadur LDAP: %sgwall wrth greu cyfeiriadur cartref ar gyfer y defnyddiwrgwall wrth amgryptio cyfrinairgwall wrth ymgychwyn SASL Cyrus: %sgwall wrth ymgychwyn y llyfrgell ldapgwall wrth lwytho modwlgwall wrth gloi ffeilgwall wrth gloi ffeil: %sgwall wrth drin priodoleddau terfynellgwall wrth addasu cofnod cyfeiriadur LDAP: %sgwall wrth symud cyfeiriadur cartref ar gyfer y defnyddiwrgwall wrth agor ffeilgwall wrth ddarllen ffeilgwall wrth ddarllen o derfynellgwall wrth ddarllen priodoleddau terfynellgwall wrth waredu'r cofnod cyfeiriadur LDAP: %sgwall wrth waredu cyfeiriadur cartref ar gyfer y defnyddiwrgwall wrth ail-enwi cofnod cyfeiriadur LDAP: %sgwall wrth ddatrys symbol mewn modwlgwall wrth osod cyfrinair yn y cyfeiriadur LDAP ar gyfer %s: %sgwall wrth osod priodoleddau terfynellgwall wrth statio ffeilgwall wrth ysgrifennu i ffeilgwall cyffredinolNid oes enw gan grŵp %jdNid oes GID gan grŵp %sNid oes enw neu GID gan grŵp %jdgwall ymgychwyn mewnolFersiwn llyfrgell/modwl yn wahanolnid yw modiwl '%s' yn diffinio '%s'analluogwyd y modwl gan gyfluniadanghydweddiad fersiwn modwl yn `%s'mae'r enw'n cynnwys nodau rheolimae'r enw'n cynnwys nod annilys `%c'mae'r enw'n cynnwys nodau di-ASCIImae'r enw'n cynnwys gofod gwynenw heb ei osodMae enw yn rhy hir (%zu > %d)mae'r enw rhy fyrEnw yn cychwyn gyda chysylltnodni chanfuwyd priodoledd `%s'dim ffwythiant ymgychwyn %s yn `%s'dim ffeil gysgod yn bresennol -- yn analluoginid oes y fath wrthrych yn y cyfeiriadur LDAPdiffyg breintiauddim yn gweithredu â breintiau'r uwchddefnydiwrnid oedd gan y gwrthrych briodoledd %snid oes gan y gwrthrych briodoledd %sllwyddiantgwall anhysbysmi fyddai datgloi yn achosi i'r maes cyfrinair fod yn wagNid oes enw gan defnyddiwr %jdNid oes UID gan defynddiwr %sNid oes enw neu UID gan defynddiwr %jdnid oedd priodoledd %s gan y gwrthrych defnyddiwrcrëwyd y gwrthrych defnyddiwr heb `%s'dynodiad defnyddiwr/grŵp mewn defnyddenw defnyddiwr/grŵp mewn defnyddLC_MESSAGES/iso_639-3.mo000064400000011222152343356400010224 0ustar00t\         ' . 9 A I P Z b j r z                   + 7 A I O W ` i q z                 " ) 4 ; C L R Z a g p x                     # ( . 9 ? E K S Z _   # +7 >HQYbk t ~  &,5 > H T^ fpx     #*3<DJ Q]dltz  &.5 <FJRW _iqx~CTRAnUGpi5 %q'b ?,^1SoQs8Yh (243B#glr=! )N_M&$:JL-t"[ ./k>90;<OWI+7]`jaD \c*d6VZXFHfKm@EePAbkhazianAfarAfrikaansAlbanianAmharicArabicArmenianAssameseAymaraAzerbaijaniBasqueBelarusianBengaliBislamaBretonBulgarianBurmeseCatalanChineseCornishCorsicanCroatianCzechDanishDutchEnglishEsperantoEstonianFaroeseFijianFinnishFrenchGeorgianGermanGuaraniGujaratiHausaHebrewHindiHungarianIcelandicIndonesianInterlingueInuktitutInupiaqIrishItalianJapaneseJavaneseKannadaKashmiriKazakhKinyarwandaKirghizKoreanKurdishLaoLatinLatvianLingalaLithuanianMacedonianMalagasyMalayalamMalteseManxMaoriMarathiMongolianNauruNorwegianOromoPolishPortuguesePushtoQuechuaRomanianRundiRussianSamoanSangoSanskritSerbianSerbo-CroatianShonaSindhiSlovakSlovenianSomaliSpanishSundaneseSwatiSwedishTagalogTajikTamilTatarTeluguThaiTibetanTsongaTswanaTurkishTurkmenTwiUighurUrduUzbekVietnameseWelshWolofXhosaYiddishYorubaZuluProject-Id-Version: iso_639-3 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2002-08-14 20:57+0100 Last-Translator: Dafydd Tomos Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit AbcasegAffaregAffricanegAlbanegAmharegArabegArmenegAsamegAimaregAserbaijaniBasgegBelarwsegBengalegBislamaLlydawegBwlgaregByrmanegCatalanegTsieinëegCernywegCorsegCroategTsiecegDanegIseldiregSaesnegEsperantoEstonegFfaröegFfijïegFfinnegFfrangegGeorgegAlmaenegGwaraniGwjwratiHawsaHebraegHindiHwngaregIslandegIndonesegInterlingueInwctitwtInwpiacGwyddelegEidalegSiapanegJafanegCanaregCashmiregCazachegCiniarwandaCirgisegCorëegCwrdegLaoegLladinLatfiegLingalaLithwanegMacedonegMalagasiMalaialamegMaltegManawegMaoriMaratiMongolegNawrŵegNorwyegOromoPwylegPortiwgalegPwshtwCetshwaRwmanegRwndiRwsiegSamöegSangoSansgritSerbegSerbo-CroategShonaSindhiSlofacegSlofenegSomaliegSbaenegSwndanegSwatiSwedegTagalogTajicegTamilegTataregTelwgwTaiTibetegTsongegTswanaTyrcegTyrcmenegTwiWigwregWrdwWsbecegFietnamegCymraegWoloffXhosaIddewegIorwbaZwlwLC_MESSAGES/iso_3166-1.mo000064400000055303152343356400010310 0ustar00 -" """"""" ""# #$#7#?# E#O# W#b#j# r#}####### ### #$3$ <$J$Q$p$$$ $$$$$$$$$% %%2%;%T%,p%%%%% % %%%%%&&%$&,J&"w&*&&&&&&'' '(':'B'J'S' o''}'$'''(!(?(D(L( S(a(r(((((((( ((( () )) )*)3) :)H)O)U)!q)))) )0)***2* 8*B*\*a*i**** ***+++++ $+/+5+H+[+m++++++++ ,,0,A,\,&e,,,, , ,,,,- -- - '- 1-<-,B-o- ------- - - ----..2.9. B. M.X. `.k.s.{.. . . . ........./ /!/(/9/'B/j/// //////0080 O0[0a0u000000"01%1:1N1c1t111111122.2F2d2x222222233,3@3R3h3y3333333 4434D4V4l44444444 5!525E5\5p55555556$6;6[6o66666666 717G7c7y777777,77 8828 L8m8 s8~8 888 8 8 888899-9=9 E9,R9 99 99999999 : :: ':3:H:O: i:t::): :::::: ;; ;%;>;E;L;T;i;~;4;;; ;$<'<@< H<S< [<!e<<#<<<<<====-=D=6S= ??????? ??? @@-@5@ ;@E@ M@ X@b@ j@u@~@ @@@@@"@@%@@A2A ;AGANAmAAA AAAAAAAAAB BB5B>BQB$eBBB"B B BBBBBBCC,2C"_C-CCCCCCCD DD-D5D=DFDfD(wD(DDDE #EDE JETE\ElEEEEEEE EE EE F FF !F,F 1F;FDF KFYF`F"fFFF0FF F1F1G 9GFG^G dGnGGGGG GG HH$H9HBHJHPHWH jHuH{HHHHHHHII2IEI\IpIIII%IIIJ J$JDJKJ_JgJoJwJ }J J JJ,JJ JJJKKKK +K 6K AKKKSK[KzKKKK K KK KKKKKKK L L#L)L1L 6LCL]LcLhLqLwLLLL#LLL M MM$$M IM TM^MtMMM MMMMMNN-NAN SNtNNNNNNNNO*O, "zZ`&z{saP?0q1h$0hXTb"c2ut;bxJ .%&iw8V3;~#A D4HU[G>d:*q=6YL7oBsm@Q(fJPBy!-kFOpSk^G\6$}C8EEo+4mwNI'~`v]N}F3 <2rn^9.=Qg[AfghanistanAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarcticaAntigua and BarbudaArab Republic of EgyptArgentinaArgentine RepublicArmeniaArubaAustraliaAustriaAzerbaijanBahamasBahrainBangladeshBarbadosBelarusBelgiumBelizeBeninBermudaBhutanBolivarian Republic of VenezuelaBoliviaBolivia, Plurinational State ofBonaire, Sint Eustatius and SabaBosnia and HerzegovinaBotswanaBouvet IslandBrazilBritish Indian Ocean TerritoryBritish Virgin IslandsBrunei DarussalamBulgariaBurkina FasoBurundiCambodiaCameroonCanadaCayman IslandsCentral African RepublicChadChileChinaChristmas IslandCocos (Keeling) IslandsColombiaCommonwealth of DominicaCommonwealth of the BahamasCommonwealth of the Northern Mariana IslandsComorosCongoCongo, The Democratic Republic of theCook IslandsCosta RicaCroatiaCubaCuraçaoCyprusCzech RepublicCôte d'IvoireDemocratic People's Republic of KoreaDemocratic Republic of Sao Tome and PrincipeDemocratic Republic of Timor-LesteDemocratic Socialist Republic of Sri LankaDenmarkDjiboutiDominicaDominican RepublicEastern Republic of UruguayEcuadorEgyptEl SalvadorEquatorial GuineaEritreaEstoniaEthiopiaFalkland Islands (Malvinas)Faroe IslandsFederal Democratic Republic of EthiopiaFederal Democratic Republic of NepalFederal Republic of GermanyFederal Republic of NigeriaFederated States of MicronesiaFederative Republic of BrazilFijiFinlandFranceFrench GuianaFrench PolynesiaFrench RepublicFrench Southern TerritoriesGabonGabonese RepublicGambiaGeorgiaGermanyGhanaGibraltarGrand Duchy of LuxembourgGreeceGreenlandGrenadaGuadeloupeGuamGuatemalaGuernseyGuineaGuinea-BissauGuyanaHaitiHashemite Kingdom of JordanHeard Island and McDonald IslandsHellenic RepublicHoly See (Vatican City State)HondurasHong KongHong Kong Special Administrative Region of ChinaHungaryIcelandIndependent State of SamoaIndiaIndonesiaIran, Islamic Republic ofIraqIrelandIslamic Republic of AfghanistanIslamic Republic of IranIslamic Republic of MauritaniaIslamic Republic of PakistanIsle of ManIsraelItalian RepublicItalyJamaicaJapanJerseyJordanKazakhstanKenyaKingdom of BahrainKingdom of BelgiumKingdom of BhutanKingdom of CambodiaKingdom of DenmarkKingdom of LesothoKingdom of MoroccoKingdom of NorwayKingdom of Saudi ArabiaKingdom of SpainKingdom of SwazilandKingdom of SwedenKingdom of ThailandKingdom of TongaKingdom of the NetherlandsKiribatiKorea, Democratic People's Republic ofKorea, Republic ofKuwaitKyrgyz RepublicKyrgyzstanLao People's Democratic RepublicLatviaLebanese RepublicLebanonLesothoLiberiaLibyaLiechtensteinLithuaniaLuxembourgMacaoMacao Special Administrative Region of ChinaMacedonia, Republic ofMadagascarMalawiMalaysiaMaldivesMaliMaltaMarshall IslandsMartiniqueMauritaniaMauritiusMayotteMexicoMicronesia, Federated States ofMoldovaMoldova, Republic ofMonacoMongoliaMontenegroMontserratMoroccoMozambiqueMyanmarNamibiaNauruNepalNetherlandsNew CaledoniaNew ZealandNicaraguaNigerNigeriaNiueNorfolk IslandNorthern Mariana IslandsNorwayOmanPakistanPalauPalestine, State ofPanamaPapua New GuineaParaguayPeople's Democratic Republic of AlgeriaPeople's Republic of BangladeshPeople's Republic of ChinaPeruPhilippinesPitcairnPlurinational State of BoliviaPolandPortugalPortuguese RepublicPrincipality of AndorraPrincipality of LiechtensteinPrincipality of MonacoPuerto RicoQatarRepublic of AlbaniaRepublic of AngolaRepublic of ArmeniaRepublic of AustriaRepublic of AzerbaijanRepublic of BelarusRepublic of BeninRepublic of Bosnia and HerzegovinaRepublic of BotswanaRepublic of BulgariaRepublic of BurundiRepublic of CameroonRepublic of ChadRepublic of ChileRepublic of ColombiaRepublic of Costa RicaRepublic of CroatiaRepublic of CubaRepublic of CyprusRepublic of Côte d'IvoireRepublic of DjiboutiRepublic of EcuadorRepublic of El SalvadorRepublic of Equatorial GuineaRepublic of EstoniaRepublic of FijiRepublic of FinlandRepublic of GhanaRepublic of GuatemalaRepublic of GuineaRepublic of Guinea-BissauRepublic of GuyanaRepublic of HaitiRepublic of HondurasRepublic of IcelandRepublic of IndiaRepublic of IndonesiaRepublic of IraqRepublic of KazakhstanRepublic of KenyaRepublic of KiribatiRepublic of LatviaRepublic of LiberiaRepublic of LithuaniaRepublic of MadagascarRepublic of MalawiRepublic of MaldivesRepublic of MaliRepublic of MaltaRepublic of MauritiusRepublic of MoldovaRepublic of MozambiqueRepublic of MyanmarRepublic of NamibiaRepublic of NauruRepublic of NicaraguaRepublic of PalauRepublic of PanamaRepublic of ParaguayRepublic of PeruRepublic of PolandRepublic of San MarinoRepublic of SenegalRepublic of SerbiaRepublic of SeychellesRepublic of Sierra LeoneRepublic of SingaporeRepublic of SloveniaRepublic of South AfricaRepublic of South SudanRepublic of SurinameRepublic of TajikistanRepublic of Trinidad and TobagoRepublic of TunisiaRepublic of TurkeyRepublic of UgandaRepublic of UzbekistanRepublic of VanuatuRepublic of YemenRepublic of ZambiaRepublic of ZimbabweRepublic of the CongoRepublic of the Marshall IslandsRepublic of the NigerRepublic of the PhilippinesRepublic of the SudanRomaniaRussian FederationRwandaRwandese RepublicRéunionSaint BarthélemySaint Helena, Ascension and Tristan da CunhaSaint Kitts and NevisSaint LuciaSaint Martin (French part)Saint Pierre and MiquelonSaint Vincent and the GrenadinesSamoaSan MarinoSao Tome and PrincipeSaudi ArabiaSenegalSerbiaSeychellesSierra LeoneSingaporeSint Maarten (Dutch part)Slovak RepublicSlovakiaSloveniaSocialist Republic of Viet NamSolomon IslandsSomaliaSouth AfricaSouth Georgia and the South Sandwich IslandsSouth SudanSpainSri LankaState of IsraelState of KuwaitState of QatarSudanSultanate of OmanSurinameSvalbard and Jan MayenSwazilandSwedenSwiss ConfederationSwitzerlandSyrian Arab RepublicTaiwanTaiwan, Province of ChinaTajikistanTanzania, United Republic ofThailandThe Former Yugoslav Republic of MacedoniaTimor-LesteTogoTogolese RepublicTokelauTongaTrinidad and TobagoTunisiaTurkeyTurkmenistanTurks and Caicos IslandsTuvaluUgandaUkraineUnion of the ComorosUnited Arab EmiratesUnited KingdomUnited Kingdom of Great Britain and Northern IrelandUnited Mexican StatesUnited Republic of TanzaniaUnited StatesUnited States Minor Outlying IslandsUnited States of AmericaUruguayUzbekistanVanuatuVenezuelaVenezuela, Bolivarian Republic ofViet NamVirgin Islands of the United StatesVirgin Islands, BritishVirgin Islands, U.S.Wallis and FutunaWestern SaharaYemenZambiaZimbabwethe State of Eritreathe State of PalestineÅland IslandsProject-Id-Version: iso_3166-1 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2017-12-28 21:49+0000 Last-Translator: Chris Leonard Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=6; plural=(n==0) ? 0 : (n==1) ? 1 : (n==2) ? 2 : (n==3) ? 3 :(n==6) ? 4 : 5; X-Generator: Weblate 2.19-dev AfghanistanAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarcticaAntigua ac BarbudaGweriniaeth Arabaidd yr AifftYr ArianninGweriniaeth yr ArianninArmeniaArubaAwstraliaAwstriaAzerbaijanY BahamasBahrainBangladeshBarbadosBelarwsGwlad BelgBelîsBeninBermudaBhutanGweriniaeth Bolifiaraidd VenezuelaBolifiaBolifia, Gwladwriaeth AmlgenedlaetholBonaire, Sint Eustatius a SabaBosnia a HerzegovinaBotswanaYnys BouvetBrasilBritish Indian Ocean TerritoryYnysoedd Virgin PrydainBrunei DarussalamBwlgariaBurkina FasoBurundiCambodiaCameroonCanadaYnysoedd y CaymanGweriniaeth Canol AffricaChadChileTsieinaYnys y NadoligYnysoedd Cocos (Keeling)ColombiaCymanwlad DominicaCymanwlad y BahamasCymanwlad Ynysoedd Gogleddol MarianaComorosCongoCongo, Gweriniaeth Ddemocrataidd yYnysoedd CookCosta RicaCroatiaCiwbaCuraçaoCyprusY Weriniaeth TsiecCôte d'IvoireGweriniaeth Democratic CorëaGweriniaeth Democrataidd Sao Tome a PrincipeGweriniaeth Democratic Timor-LesteGweriniaeth Sosialaidd Democrataidd Sri LankaDenmarcDjiboutiDominicaGweriniaeth DominicaGweriniaeth Dwyreiniol UruguayEcwadorYr AifftEl SalvadorGuinea CyhydeddolEritreaEstoniaEthiopiaYnysoedd y Falklands (Malvinas)Ynysoedd y FfaroGweriniaeth Democratic Ffederal EthiopiaGweriniaeth Ddemocrataidd Ffederal NepalGweriniaeth Ffederal yr AlmaenGweriniaeth Ffederal NigeriaTaleithiau Cyfunol MicronesiaGweriniaeth Ffedereiddiol BrasilFfijiY FfindirFfraincGuiana FfrangegPolynesia FfrangegGweriniaeth FfraincFrench Southern TerritoriesGabonGweriniaeth GabonGambiaGeorgiaYr AlmaenGhanaGibraltarArchddugiaeth LwcsembwrgGroegGreenlandGrenadaGuadeloupeGuamGwatemalaGuernseyGuineaGuinea-BissauGuyanaHaitiGweriniaeth Hashemeit yr IorddonenYnys Heard ac Ynysoedd McDonaldGweriniaeth GroegYr Esgobaeth Sanctaidd (Talaith Dinas y Fatican)HondurasHong KongHong Kong, Rhanbarth Gweinyddol Arbennig o TseinaHwngariGwlad yr IâTalaith Annibynol SamoaIndiaIndonesiaIran, Gweriniaeth IslamaiddIracIwerddonGweriniaeth Islamaidd PacistanGweriniaeth Islamaidd IranGweriniaeth Islamaidd MauritaniaGweriniaeth Islamaidd PacistanYnys ManawIsraelGweriniaeth yr EidalYr EidalJamaicaJapanJerseyGwlad Yr IorddonenKazakhstanKenyaTeyrnas BahrainBrenhiniaeth BelgBrenhiniaeth BhutanBrenhiniaeth CambodiaBrenhiniaeth DenmarcBrenhiniaeth LesothoBrenhiniaeth MoroccoBrenhiniaeth NorwyGweriniaeth Saudi ArabiaBrenhiniaeth SbaenBrenhiniaeth SwazilandGweriniaeth y SwdanBrenhiniaeth Gwlad ThaiBrenhiniaeth TongaBrenhiniaeth yr IseldiroeddKiribatiKorea (Gweriniaeth Democrataidd Pobl)Corëa, GweriniaethCoweitGweriniaeth KyrgyzKyrgyzstanGweriniaeth Ddemocrataidd y Bobl LaoLatfiaGweriniaeth LebanonLebanonLesothoLiberiaLibyaLiechtensteinLithwaniaLwcsembwrgMacaoRhanbarth Gweinyddol Arbennig o Tseina MacaoMacedonia, GweriniaethMadagascarMalawiMalaysiaMaldivesMaliMaltaYnysoedd MarshallMartiniqueMauritaniaMauritiusMayotteMecsicoMicronesia, Taleithiau CyfunolMoldofaMoldofa, GweriniaethMonacoMongoliaMontenegroMontserratMorocoMozambiqueMyanmarNamibiaNauruNepalYr IseldiroeddCaledonia NewyddSeland NewyddNicaraguaNigerNigeriaNiueYnys NorfolkYnysoedd Northern MarianaNorwyOmanPacistanPalauPalestina, GwladwriaethPanamaPapua Guinea NewyddParaguayGweriniaeth Democratic Pobl AlgeriaGweriniaeth Pobl BangladeshGweriniaeth Pobl TseinaPeriwPilipinasPitcairnGwladwriaeth Amlgenedlaethol BolifiaGwlad PwylPortiwgalGweriniaeth PortiwgalTywysogaeth AndorraTywysogaeth LiechtensteinTywysogaeth MonacoPuerto RicoQatarGweriniaeth AlbaniaGweriniaeth AngolaGweriniaeth ArmeniaGweriniaeth AwstriaGweriniaeth AzerbaijanGweriniaeth BelarwsGweriniaeth BeninGweriniaeth Bosnia a HerzegovinaGweriniaeth BotswanaGweriniaeth BwlgariaGweriniaeth BurundiGweriniaeth CameroonGweriniaeth ChadGweriniaeth ChileGweriniaeth ColombiaGweriniaeth Costa RicaGweriniaeth CroatiaGweriniaeth CiwbaGweriniaeth CyprusGweriniaeth Côte d'IvoireGweriniaeth DjiboutiGweriniaeth EcuadorGweriniaeth El SalvadorGweriniaeth Guinea CyhydeddolGweriniaeth EstoniaGweriniaeth FijiGweriniaeth y FfindirGweriniaeth GhanaGweriniaeth GwatemalaGweriniaeth GuineaGweriniaeth Guinea-BissauGweriniaeth GuyanaGweriniaeth HaitiGweriniaeth HondurasGweriniaeth Gwlad yr IâGweriniaeth IndiaGweriniaeth IndonesiaGweriniaeth IracGweriniaeth KazakhstanGweriniaeth KenyaGweriniaeth y KiribatiGweriniaeth LatfiaGweriniaeth LiberiaGweriniaeth LithwaniaGweriniaeth MadagascarGweriniaeth MalawiGweriniaeth y MaldivesGweriniaeth MaliGweriniaeth MaltaGweriniaeth MauritiusGweriniaeth MoldovaGweriniaeth MozambiqueGweriniaeth MyanmarGweriniaeth NamibiaGweriniaeth NauruGweriniaeth NicaraguaGweriniaeth PalauGweriniaeth PanamaGweriniaeth ParaguayGweriniaeth PeriwGweriniaeth Gwlad PwylGweriniaeth San MarinoGweriniaeth SenegalGweriniaeth SerbiaGweriniaeth y SeychellesGweriniaeth Sierra LeoneGweriniaeth SingaporeGweriniaeth SlofeniaGweriniaeth De AffricaGweriniaeth De SwdanGweriniaeth y SurinameGweriniaeth TajikistanGweriniaeth Trinidad a TobagoGweriniaeth TwnisiaGweriniaeth TwrciGweriniaeth UgandaGweriniaeth WsbecistanGweriniaeth VanuatuGweriniaeth YemenGweriniaeth ZambiaGweriniaeth ZimbabweGweriniaeth y CongoGweriniaeth Ynysoedd MarshallGweriniaeth NigeriaGweriniaeth y PilipinasGweriniaeth y SwdanRwmaniaFfederasiwn RwsiaRwandaGweriniaeth RwandaRéunionSaint BarthélemySaint Helena, Dyrchafael a Tristan da CunhaSaint Kitts a NevisSaint LuciaSaint Martin (rhan Ffrengig)Saint Pierre a MiquelonSaint Vincent a'r GrenadinesSamoaSan MarinoSao Tome a PrincipeSaudi ArabiaSenegalSerbiaSeychellesSierra LeoneSingaporeSint Maarten (Rhan Iseldiraidd)Gweriniaeth SlofacaiddSlofaciaSlofeniaGweriniaeth Sosialaidd FietnamYnysoedd SolomonSomaliaDe AffricaDe Georgia ac Ynysoedd De SandwichDe SwdanSbaenSri LankaTalaith IsraelTalaith CoweitTalaith QatarY SwdanSwltaniaeth OmanSurinameSvalbard a Jan MayenSwazilandSwedenY Conffederasiwn SwisaiddY SwistirGweriniaeth Arabaidd SyriaTaiwanTaiwan, Talaith o TseinaTajikistanTanzania, Gweriniaeth UnedigGwlad ThaiCyn-weriniaeth Iwgoslafaidd MacedoniaTimor-LesteTogoGweriniaeth TogoTokelauTongaTrinidad a TobagoTwnisiaTwrciTurkmenistanYnysoedd y Turks a CaicosTuvaluUgandaWcrainUndeb y ComorosEmiriaethau Arabaidd UnedigY Deyrnas UnedigTeyrnas Unedig Prydain Fawr a Gogledd IwerddonTaleithiau Unedig MecsicoGweriniaeth Unedig TanzaniaYr Unol DaleithiauMân Ynysoedd Pellenig yr Unol DaleithiauUnol Daleithiau AmericaUruguayWsbecistanVanuatuVenezuelaVenezuela, Gweriniaeth BolifaraiddFietnamYnysoedd Virgin Unol Daleithiau AmericaYnysoedd Virgin, PrydeinigYnysoedd Virgin, U.D.A.Wallis a FutunaGorllewin SaharaYemenZambiaZimbabweGwladwriaeth EritreaGwladwriaeth PalesteinaYnysoedd ÅlandLC_MESSAGES/Linux-PAM.mo000064400000001066152343356400010410 0ustar00$,89Project-Id-Version: Linux-PAM Report-Msgid-Bugs-To: http://sourceforge.net/projects/pam POT-Creation-Date: 2018-05-18 12:58+0200 PO-Revision-Date: 2011-11-30 06:56-0500 Last-Translator: FULL NAME Language-Team: Welsh (http://www.transifex.com/projects/p/fedora/language/cy/) Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; X-Generator: Zanata 3.8.3 LC_MESSAGES/chkconfig.mo000064400000017454152343356400010641 0ustar00Tq\ !#-:<h"$%@+f(  . A 4L  6     B &G n -q  * ( L MI .     ;$ ` z  # $ & , I b     *F_!}''8 ( IjnAq9! ) 5&A`h#&>A0@1J!h#$,)*,C p~ ':Kah&pB0 . ?%L"rEH.$&S"z?1L#i+<3*?_'~ 0!Hj01@&,%SyCF"6Y h+vt%6\zHL)MJ'#T 8-N"(C@9H*; 3O2=>:7K? ,. +Q D15!4<FISBP$0&EG6%A/R  error reading choice [--initscript ] --altdir --admindir %s --add %s --del %s --override alternatives --auto alternatives --config alternatives --display alternatives --remove alternatives --set Selection Command link currently points to %s slave %s: %s %s - status is auto. %s - status is manual. %s already exists %s empty! %s has not been configured as an alternative for %s %s version %s %s version %s - Copyright (C) 1997-2000 Red Hat, Inc. (would remove %s BackCancelCurrent `best' version is %s. Enter to keep the current selection[+], or type selection number: No services may be managed by ntsysv! OkPress for more information on a service.ServicesThere are %d programs which provide '%s'. There is %d program that provides '%s'. This may be freely redistributed under the terms of the GNU Public License. This may be freely redistributed under the terms of the GNU Public License. What services should be automatically started?You must be root to run %s. admindir %s invalid altdir %s invalid alternatives version %s alternatives version %s - Copyright (C) 2001 Red Hat, Inc. bad argument to --levels bad mode on line 1 of %s bad primary link in %s cannot determine current run level error reading from directory %s: %s error reading info for service %s: %s error reading information on service %s: %s failed to create %s: %s failed to glob pattern %s: %s failed to link %s -> %s: %s failed to make symlink %s: %s failed to open %s/init.d: %s failed to open %s: %s failed to open directory %s: %s failed to read %s: %s failed to read link %s: %s failed to remove %s: %s failed to remove link %s: %s failed to replace %s with %s: %s link %s incorrect for slave %s (%s %s) link changed -- setting mode to manual link points to no alternative -- setting mode to manual missing path for slave %s in %s numeric priority expected in %s offononly one of --list, --add, --del, or --override may be specified only one runlevel may be specified for a chkconfig query path %s unexpected in %s path to alternate expected in %s reading %s running %s service %s does not support chkconfig service %s supports chkconfig, but is not referenced in any runlevel (run 'chkconfig --add %s') slave path expected in %s the primary link for %s must be %s unexpected end of file in %s unexpected line in %s: %s usage: alternatives --install would link %s -> %s would remove %s xinetd based services: Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2017-07-25 13:31+0200 PO-Revision-Date: 2015-01-05 06:07+0000 Last-Translator: Copied by Zanata Language-Team: LANGUAGE Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; X-Generator: Zanata 4.6.2 gwall wrth ddarllen dewis [--initscript ] --altdir --admindir %s --add %s --del %s --override alternatives --auto alternatives --config alternatives --display alternatives --remove alternatives --set Dewisiad Gorchymyn mae'r cyswllt yn pwyntio at %s yn gyfredol gwas %s: %s %s - awto yw'r statws. %s - 'â llaw' yw'r statws. Mae %s yn bodoli eisioes %s yn wag! ni chyfluniwyd %s yn amgen ar gyfer %s %s fersiwn %s %s fersiwn %s - Hawlfraint (h)(C) 1997-2000 Red Hat, Inc. (byddai'n gwaredu %s Yn ôlDiddymu%s yw'r fersiwn `orau' ar hyn o bryd. Dychwelydd i gadw'r dewisiad cyfredol[+], neu teipiwch rif dewis. Ni ellir trefnu unrhyw wasanaethau drwy ntsysv! IawnGwasgwch am fwy o wybodaeth am wasanaeth.GwasanaethauMae %d o raglenni sy'n darparu '%s'. Mae %d rhaglen sy'n darparu '%s'. Gellir dosbarthu hwn yn rhydd o dan dermau'r Drwydded Gyhoeddus GNU. Gellir ailddosbarthu hwn yn rhydd o dan dermau Trwydded Gyhoeddus GNU. Pa wasanaethau y dylid eu dechrau'n awtomatig?Rhaid i chi fod yn wraidd i redeg %s. cyfeiriadur gweinyddol %s annilys cyfeiriadur amgen %s annilys alternatives fersiwn %s alternatives fersiwn %s - Hawlfraint (h)(C) 2001 Red Hat, Inc. ymresymiad gwael i --levels modd gwael ar linell 1 %s cyswllt cynradd gwael yn %s methu pennu'r lefel redeg gyfredol gwall wrth ddarllen o'r cyfeiriadur %s: %s gwall wrth ddarllen gwybodaeth ar gyfer y gwasanaeth %s: %s gwall wrth ddarllen gwybodaeth ar wasanaeth %s: %s methwyd creu %s: %s methwyd globio'r patrwm %s: %s methwyd cysylltu %s -> %s: %s methwyd creu cyswllt symbolaidd %s: %s methwyd agor %s/init.d: %s methwyd agor %s: %s methwyd agor cyfeiriadur %s: %s methwyd darllen %s: %s methwyd darllen cyswllt %s: %s methwyd gwaredu %s: %s methwyd gwaredu'r cyswllt %s: %s methwyd amnewid %s â %s: %s cyswllt %s yn anghywir ar gyfer gwas %s (%s %s) newidiwyd cyswllt -- yn gosod y modd i 'â llaw' cyswllt ddim yn pwyntio at amgen -- yn gosod y modd i 'â llaw' llwybr ar goll ar gyfer gwas %s yn %s disgwyliwyd blaenoriaeth rifol yn %s wedi'i ddiffoddynghyndim ond un o --list, --add, --del, neu --override y ceir ei benodi dim ond un lefel rhedeg y ceir ei phenodi ar gyfer chwiliad chkconfig llwybr %s annisgwyl yn %s disgwyliwyd llwybr at amgen yn %s yn dechrau %s yn rhedeg %s nid yw'r gwasanaeth %s yn cynnal chkconfig mae'r gwasanaeth %s yn cynnal chkconfig, ond ni chyfeirir ato yn unrhyw lefel rhedeg (rhedwch 'chkconfig --add %s') disgwyliwyd llwybr gwas yn %s rhaid i gyswllt cynradd %s fod yn %s diwedd ffeil annisgwyl yn %s llinell annisgwyl yn %s: %s defnydd: alternatives --install byddai'n cysylltu %s -> %s byddai'n gwaredu %s gwasanaethau sail xinetd: LC_MESSAGES/p11-kit.mo000064400000001064152343356400010062 0ustar00$,89Project-Id-Version: p11-kit Report-Msgid-Bugs-To: https://bugs.freedesktop.org/enter_bug.cgi?product=p11-glue POT-Creation-Date: 2015-02-20 21:29+0100 PO-Revision-Date: 2012-02-29 09:23+0000 Last-Translator: FULL NAME Language-Team: Welsh (http://www.transifex.com/freedesktop/p11-kit/language/cy/) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Language: cy Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; LC_MESSAGES/glib20.mo000064400000065445152343356400007770 0ustar00o  !Y2_aNh&(#%?!W4y/# 8,T%&")! =A^;?.{*.*a/F42 :@A{@;W:W1/ %L ?r 5 I 2! !!!"8"!T"v"""" ""#/#G#c####!##$,!$N$f$:$.$$>%'C%.k%%?%)%$#&%H&n&!&9&*&9 'C'-`'+''&E(+l(3(#(!())8<)9u).)-). *;* R*`***** * * *&+)+3I+)}++++++ ,$",+G,!s,,1,.,T-Hi-F-=-L7.+.!..-.$ /(E/n/1/<//&09;0u0)00L0N1h1z22282-25+3*a3/33333$40?4Fp4:4-42 5S5;k5'5-5)5'6;6!R6(t6066*6O7Cb7"77&7*8;8 M8CZ88808.83 9-A9o9 999999:,:G:b:}:::::;+;DH;; ;;;;;<<2<G<\<r<<<<<<=!===!X=z="===)=> > 7>E>&]>>'>=>?? 2?@? `? ? ??AAAAAAA A BBG"BXjBXBC!8CZC.lCC*C!CCD'3D=[D8D DD#E*E2JE.}E2E!E%F$'F#LF:pFF2;G4nG,G,G/Gd-HLH=H8I=VICI-I?JfFJZJ5K2>K8qKLK@KM8LL#M4M$OMtMM2M&MN N?NVNsNNN#NNO ,OMO&kOO&OKO'#PKP>jP0P"PFP'DQ.lQQ>Q+Q&$R&KRrR#R9R.RESZS3xS-S~S%YT*T3T%T"U-'U8UU;U7U6V79VqV V.VVVVVWWW<W)UWAW,WWXX+XAXYX*qX(X#X X5 Y<@Y\}YLYL'ZJtZ_Z6[(V[0[;[,[4\N\Af\F\0\; ]D\]!]9]]I^E_^^hA___?_4`JL`*`2``a'a"Fa)ia7aTa6 b6Wb?bb5b,c2Kc(~ccc%c%c;"d^d'}dPd?d!6eXe*we1ee eWeMfUf8^f'f/f(fg 7gCgVgkgogsgwg{ggggggggggLgg hh .hMm O/ '^n,RZ9.wNHha&#0Lt4 lU`3 ?F\YXbu1* <7~S5K{BW  P=dv(:D[ o  "$6jVEJe-zQGsC)riy}x_Afk+pc8%2| (invalid encoding)%.1f EB%.1f GB%.1f KB%.1f MB%.1f PB%.1f TB%s filetype%s type%u byte%u bytes'%s' is not a valid character following a '<' character; it may not begin an element name'%s' is not a valid character following the characters '''%s' is not a valid name '%s' is not a valid name: '%c' ) without opening (A bookmark for URI '%s' already existsApplication Options:Attribute '%s' of element '%s' not foundCan't copy directory over directoryCan't copy over directoryCan't copy special fileCan't create user desktop file %sCan't do a raw read in g_io_channel_read_line_stringCan't do a raw read in g_io_channel_read_to_endCan't move directory over directoryCan't open directoryCan't recursively copy directoryCan't rename root directoryCannot convert fallback '%s' to codeset '%s'Cannot parse double value '%s' for %sCannot parse integer value '%s' for %sCannot truncate GMemoryInputStreamChannel terminates in a partial characterCharacter out of range for UTF-16Character out of range for UTF-8Character reference '%-.*s' does not encode a permitted characterCharacter reference did not end with a semicolon; most likely you used an ampersand character without intending to start an entity - escape ampersand as &Conversion from character set '%s' to '%s' is not supportedCould not allocate %lu bytes to read file "%s"Could not open converter from '%s' to '%s'Could not open converter from '%s' to '%s': %sDEFINE group contains more than one branchDocument ended unexpectedly after the equals sign following an attribute name; no attribute valueDocument ended unexpectedly inside a comment or processing instructionDocument ended unexpectedly inside an attribute nameDocument ended unexpectedly inside an element nameDocument ended unexpectedly inside an element-opening tag.Document ended unexpectedly inside the close tag for element '%s'Document ended unexpectedly just after an open angle bracket '<'Document ended unexpectedly while inside an attribute valueDocument ended unexpectedly with elements still open - '%s' was the last element openedDocument ended unexpectedly, expected to see a close angle bracket ending the tag <%s/>Document must begin with an element (e.g. )Document was empty or contained only whitespaceDouble value '%s' for %s out of rangeElement '%s' was closed, but the currently open element is '%s'Element '%s' was closed, no element is currently openEmpty entity '&;' seen; valid entities are: & " < > 'Entity did not end with a semicolon; most likely you used an ampersand character without intending to start an entity - escape ampersand as &Entity name '%-.*s' is not knownError closing file: %sError creating backup copy: %sError creating directory: %sError during conversion: %sError getting filesystem info: %sError making symbolic link: %sError moving file: %sError on line %d char %d: Error on line %d: %sError opening directory '%s': %sError opening file '%s': %sError opening file: %sError parsing option %sError reading file '%s': %sError reading from file: %sError removing file: %sError removing old file: %sError renaming file: %sError renaming temporary file: %sError seeking in file: %sError setting symlink: %sError setting symlink: file is not a symlinkError trashing file: %sError truncating file: %sError while compiling regular expression %s at char %d: %sError while matching regular expression %s: %sError writing to file: %sExisting file '%s' could not be removed: g_unlink() failed: %sFailed to change to directory '%s' (%s)Failed to close file '%s': fclose() failed: %sFailed to create file '%s': %sFailed to create pipe for communicating with child process (%s)Failed to execute child process "%s" (%s)Failed to execute child process (%s)Failed to execute helper program (%s)Failed to fork (%s)Failed to fork child process (%s)Failed to get attributes of file '%s': fstat() failed: %sFailed to map file '%s': mmap() failed: %sFailed to open file '%s' for writing: fdopen() failed: %sFailed to open file '%s': %sFailed to open file '%s': fdopen() failed: %sFailed to open file '%s': open() failed: %sFailed to parse '%-.*s', which should have been a digit inside a character reference (ê for example) - perhaps the digit is too largeFailed to read data from child processFailed to read data from child process (%s)Failed to read enough data from child pid pipe (%s)Failed to read from child pipe (%s)Failed to read from file '%s': %sFailed to read the symbolic link '%s': %sFailed to redirect output or input of child process (%s)Failed to rename file '%s' to '%s': g_rename() failed: %sFailed to write file '%s': fflush() failed: %sFailed to write file '%s': fsync() failed: %sFailed to write file '%s': fwrite() failed: %sFile "%s" is too largeFile is emptyFile names cannot contain '%c'GDateTime%H:%M:%SGDateTime%I:%M:%S %pGDateTime%a %b %e %H:%M:%S %YGDateTime%m/%d/%yGDateTimeAMGDateTimePMHelp Options:Integer value '%s' for %s out of rangeInteger value '%s' out of rangeInvalid UTF-8 encoded text in name - not valid '%s'Invalid byte sequence in conversion inputInvalid filenameInvalid filename %sInvalid group name: %sInvalid hostnameInvalid key name: %sInvalid program name: %sInvalid sequence in conversion inputInvalid string in argument vector at %d: %sInvalid string in environment: %sInvalid working directory: %sKey file contains escape character at end of lineKey file contains invalid escape sequence '%s'Key file contains key '%s' in group '%s' which has value that cannot be interpreted.Key file contains key '%s' which has a value that cannot be interpreted.Key file contains key '%s' which has value that cannot be interpreted.Key file contains key '%s' with value '%s' which is not UTF-8Key file contains line '%s' which is not a key-value pair, group, or commentKey file contains unsupported encoding '%s'Key file does not have group '%s'Key file does not have key '%s'Key file does not have key '%s' in group '%s'Key file does not start with a groupLeftover unconverted data in read bufferMissing argument for %sNo MIME type defined in the bookmark for URI '%s'No application with name '%s' registered a bookmark for '%s'No bookmark found for URI '%s'No groups set in bookmark for URI '%s'No private flag has been defined in bookmark for URI '%s'No type for class name %sNo valid bookmark file found in data dirsNot a regular fileOdd character '%s', expected a '=' after attribute name '%s' of element '%s'Odd character '%s', expected a '>' character to end the empty-element tag '%s'Odd character '%s', expected a '>' or '/' character to end the start tag of element '%s', or optionally an attribute; perhaps you used an invalid character in an attribute nameOdd character '%s', expected an open quote mark after the equals sign when giving value for attribute '%s' of element '%s'Operation not supportedOperation was cancelledPCRE library is compiled without UTF8 properties supportPCRE library is compiled without UTF8 supportPOSIX named classes are supported only within a classPartial character sequence at end of inputQuoted text doesn't begin with a quotation markShow all help optionsShow help optionsStream is already closedSymbolic links not supportedTemplate '%s' doesn't contain XXXXXXTemplate '%s' invalid, should not contain a '%s'Text ended before matching quote was found for %c. (The text was '%s')Text ended just after a '\' character. (The text was '%s')Text was empty (or contained only whitespace)The URI '%s' contains invalidly escaped charactersThe URI '%s' is invalidThe URI '%s' is not an absolute URI using the "file" schemeThe hostname of the URI '%s' is invalidThe local file URI '%s' may not include a '#'The pathname '%s' is not an absolute pathTrash not supportedType %s is not classedUnable to create trash dir %s: %sUnable to find or create trash directoryUnable to find terminal required for applicationUnable to trash file: %sUnexpected attribute '%s' for element '%s'Unexpected error in g_io_channel_win32_poll() reading data from a child processUnexpected error in select() reading data from a child process (%s)Unexpected error in waitpid() (%s)Unexpected tag '%s' inside '%s'Unexpected tag '%s', tag '%s' expectedUnknown error executing child process "%s"Unknown option %sUnknown typeUnmatched quotation mark in command line or other shell-quoted textUnnamedUsage:Valid key file could not be found in search dirsValue '%s' cannot be interpreted as a boolean.Value '%s' cannot be interpreted as a float number.Value '%s' cannot be interpreted as a number.Wrong number of tokens (%d)[OPTION...]\ at end of pattern\c at end of patternabbreviated month nameAprabbreviated month nameFebabbreviated month nameJanabbreviated month nameJulabbreviated month nameJunabbreviated month nameMarabbreviated month nameMayabbreviated weekday nameFriabbreviated weekday nameMonabbreviated weekday nameSatabbreviated weekday nameSunabbreviated weekday nameThuabbreviated weekday nameTueabbreviated weekday nameWedback references as conditions are not supported for partial matchingbacktracking limit reachedcode overflowcorrupted objectdigit expectedfailed to get memoryfull month nameAprilfull month nameFebruaryfull month nameJanuaryfull month nameJulyfull month nameJunefull month nameMarchfull month nameMayfull weekday nameFridayfull weekday nameMondayfull weekday nameSaturdayfull weekday nameSundayfull weekday nameThursdayfull weekday nameTuesdayfull weekday nameWednesdayhexadecimal digit expectedhexadecimal digit or '}' expectedinternal errorinternal error or corrupted objectmissing ) after commentmissing terminating )missing terminating ] for character classnothing to repeatoctal value is greater than \377out of memoryrecursion limit reachedrecursive call could loop indefinitelyregular expression too largerepeating a DEFINE group is not allowedthe pattern contains items not supported for partial matchingunexpected repeatunknown POSIX class nameunknown errorunrecognized character after (?unrecognized character after (?<unrecognized character after (?Punrecognized character follows \Project-Id-Version: glib Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=glib&keywords=I18N+L10N&component=general POT-Creation-Date: 2011-09-04 23:56-0400 PO-Revision-Date: 2009-12-21 14:56+0100 Last-Translator: Iestyn Pryce Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n==2) ? 1 : 0; X-Generator: Virtaal 0.5.0 (amgodiad annilys)%.1f EB%.1f GB%.1f KB%.1f MB%.1f PB%.1f TBmath ffeil %smath %s%u beit%u beitNid yw '%s' yn nod dilys yn dilyn '<'; nid yw'n gallu dechrau enw elfenNid yw '%s' yn nod ddilys yn dilyn y nodau 'Rhaid i'r ddogfen ddechrau gydag elfen (e.e. )Roedd y ddogfen yn wag neu'n cynnwys gofod yn unigMae'r gwerth dwbl '%s' ar gyfer %s y tu allan i'r cwmpasCafodd yr elfen '%s' ei gau, ond yr elfen sydd ar agor ar hyn o bryd yw '%s'Cafodd yr elfen '%s' ei gau, nid oes elfen ar agor ar hyn o brydGwelwyd endid gwag '&;'; mae & " < > a ' yn endidau dilysNi orffennwyd yr endid gyda hanner-colon - mwy na thebyg y defnyddiwyd ampersand heb fwriadu dechrau endid - dylid defnyddio & yn lleMae'r enw endid '%-.*s' yn anhysbysGwall wrth cau ffeil': %s Gwall wrth greu copï wrth gefn: %s Gwall wrth creu plygell: %sGwall wrth drawsnewid: %sGwall wrth gyrchu gwybodaeth y system ffeiliau: %sGwall wrth creu cyswllt symbolaidd: %sGwall wrth symud ffeil: %s Gwall ar linell %d golofn %d: Gwall ar linell %d: %sGwall y cyfeiriadur '%s': %sGwall wrth agor ffeil '%s': %s Gwall wrth agor ffeil: %s Gwall wrth ramadegu opsiwn %sGwall wrth ddarllen ffeil '%s': %s Gwall wrth ddarllen ffeil: %s Gwall wrth gwaredu ffeil: %sGwall wrth gwaredu hen ffeil: %sGwall wrth ailenwi ffeil: %s Gwall wrth ailenwi ffeil dros dro: %s Gwall wrth chwilio ffeil: %s Gwall wrth osod cyswllt symbolaidd: %sGwall wrth osod cyswllt symbolaidd: dydy'r ffeil ddim yn gyswllt symbolaiddGwall wrth rhoi ffeil yn y sbwriel: %s Gwall wrth talfyrru ffeil: %s Gwall tra'n crynhoi'r mynegiad cyffredinol %s ar golofn %d: %sGwall tra'n gweddu y mynegiad cyffredinol %s: %sGwall wrth ysgrifennu i ffeil: %s Methu tynnu'r ffeil '%s' oedd eisoes yn bodoli: methodd g_unlink(): %sMethwyd newid i'r cyfeiriadur '%s' (%s)Methwyd cau'r ffeil '%s': methodd fclose(): %sMethwyd creu'r ffeil '%s': %sMethwyd creu pibell er mwyn cyfathrebu â phroses plentyn (%s)Methwyd gweithredu proses plentyn "%s" (%s)Methwyd gweithredu proses plentyn (%s)Methwyd gweithredu proses cymorth (%s)Methwyd fforcio (%s)Methwyd fforcio proses plentyn (%s)Methwyd darllen agweddau ffeil '%s': methiant fstat(): %sMethwyd mapio'r ffeil '%s': methodd mmap(): %sMethu agor y ffeil '%s' er mwyn ysgrifennu iddi: methodd fdopen(): %sMethwyd agor y ffeil '%s': %sMethwyd agor y ffeil '%s': methiant yn fdopen(): %sMethwyd agor y ffeil '%s': methodd open(): %sMethwyd adnabod '%-.*s', a ddylai fod yn ddigid o fewn cyfeiriant nod (ê er enghraifft) - hwyrach fod y digid yn rhy fawrMethwyd darllen data o broses plentynMethwyd darllen data o broses plentyn (%s)Methwyd darllen digon o ddata o bibell plentyn (%s)Methwyd darllen o bibell plentyn (%s)Methwyd darllen o'r ffeil '%s': %sMethwyd darllen y cyswllt symbolaidd '%s': %sMethwyd ailgyrchu mewnbwn neu allbwn proses blentyn (%s)Methwyd ail-enwi'r ffeil'%s' i '%s': methodd g_rename(): %sMethwyd ysgrifennu i'r ffeil '%s': methodd fflush(): %sMethwyd ysgrifennu i'r ffeil '%s': methodd fsync(): %sMethwyd ysgrifennu i'r ffeil '%s': methodd fwrite(): %sMae'r ffeil "%s" yn rhy fawrFfeil yn wagDydy enwai ffeiliau ddim yn gallu cynnwys '%c'%T%l:%M:%S %P %ZDydd %A %d mis %B %Y %T %Z%d.%m.%yAMPMCymorth Opsiynau:Mae'r gwerth cyfanrif '%s' ar gyfer %s y tu allan i'r cwmpasGwerth cyfanrif '%s' y tu allan i'r ystodTestun annilys wedi ei amgodio fel UTF-8 yn yr enw - '%s' annilysDilyniant beit annilys ym mewnbwn trawsnewidEnw ffeil annilysEnw ffeil annilys %sEnw grŵp annilys: %sEnw gwesteiwr annilysEnw allwedd annilys: %sEnw rhaglen annilys: %sDilyniant annilys ym mewnbwn trawsnewidiadArg ar goll yn y fector argiau yn %d: %sLlinyn annilys yn yr amgylchedd: %sCyfeiriadur gweithio annilys: %sFfeil allwedd yn cynnwys nod dianc ar ddiwedd llinellFfeil allwedd yn cynnwys '%s', sy'n ddilyniant dianc annilysFfeil allwedd yn cynnwys yr allwedd '%s' yng ngrŵp '%s' sydd â gwerth na ellir ei ddirnad.Ffeil allwedd yn cynnwys yr allwedd '%s' sydd â gwerth na ellir ei ddirnad.Ffeil allwedd yn cynnwys yr allwedd '%s' sydd â gwerth na ellir ei ddirnad.Ffeil allwedd yn cynnwys yr allwedd '%s' gyda'r gwerth '%s' nad yw'n UTF-8Ffeil allwedd yn cynnwys y llinell '%s' sydd ddim yn bâr allwedd-gwerth, na'n grŵp, na'n sylwFfeil allwedd yn cynnwys yr amgodiad '%s', na gynhelirNid oes gan y ffeil allwedd y grŵp '%s'Ffeil allwedd heb fod yn cynnwys yr allwedd '%s'Ffeil allwedd heb fod ganddi'r allwedd '%s' yn y grŵp '%s'Nid yw'r ffeil allwedd yn dechrau gyda grŵpData dros ben heb ei drawsnewid yn y byffer ddarllenArg ar goll ar gyfer %sDim math MIME wedi'i ddiffinio yn y llyfrnod ar gyfer yr URI '%s'Does dim un rhaglen o'r enw '%s' wedi cofrestru llyfrnod ar gyfer '%s'Dim llyfrnod wedi ei ganfod ar gyfer yr URI '%s'Dim grwpiau wedi'u gosod yn y llyfrnod ar gyfer yr URI '%s'Dim baner breifat wedi'i diffinio yn y llyfrnod ar gyfer yr URI '%s'Dim fath ar gyfer enw dosbarth %sNi ddarganfuwyd ffeil llyfrnodau ddilys yn y plygell dataDdim yn ffeil cyffredinNod od '%s', disgwyliwyd '=' ar ôl yr enw priodoledd '%s' o'r elfen '%s'Nod od '%s', disgwyliwyd nod '>' er mwyn gorffen y tag elfen wag '%s'Nod od '%s', disgwyliwyd '>' neu '/' er mwyn gorffen tag dechrau'r elfen '%s', neu briodoledd ddewisol; efallai defnyddiwyd nod annilys mewn enw priodoleddNod od '%s', disgwyliwyd dyfynnod agored ar ôl y '=' wrth roi gwerth i'r priodoledd '%s' o'r elfen '%s'Ni chynhelir y weithredDiddymwyd y weithredMae'r llyfrgell PCRE wedi'i grynhoi heb cymorth rhinweddau UTF8Mae'r llyfrgell PCRE wedi'i grynhoi heb cymorth UTF8Mae dosbarthiadau POSIX a enwyd yn cael eu cefnogi o fewn dosbarth yn unigDilyniant nod rhannol ar ddiwedd y mewnbwnNid yw'r testun dyfynedig yn dechrau gyda dyfynnodDangos bob opsiwn cymorthDangos opsiynau cymorthMae'r llif wedi'i gau yn barodNi chynhelir cysylltion symbolaiddNid yw'r patrymlun '%s' yn cynnwys XXXXXXMae'r patrymlun '%s' yn annilys: ni ddylai gynnwys '%s'Gorffennodd y testun cyn y darganfuwyd dyfynnod i gydweddu %c. ('%s' oedd y testun.)Gorffennodd y testun ar ôl '\'. ('%s' oedd y testun.)Roedd y testun yn wag, neu'n cynnwys gofodnodau'n unigMae'r LAU '%s' yn cynnwys nodau wedi eu dianc mewn modd annilysMae'r LAU '%s' yn annilysNid yw'r LAU '%s' yn LAU absoliwt yn y cynllun "file"Mae'r enw gwesteiwr yn y LAU '%s' yn annilysNi chaniateir i'r LAU ffeil lleol '%s' gynnwys '#'Nid yw'r llwybr '%s' yn llwybr gosodedigNi chynhelir sbwrielDydy %s heb ei ddosbarthuMethwyd creu'r plygell sbwriel %s: %sMethu canfod na chreu plygell sbwrielMethwyd canfod y terfynell angenrheidiol ar gyfer y rhaglenMethwyd creu ffeil sbwriel: %sPriodwedd annisgwyl '%s' i'r elfen '%s'Gwall annisgwyl yn g_io_channel_win32_poll() wrth ddarllen data o broses plentynGwall annisgwyl yn select() wrth ddarllen o broses plentyn (%s)Gwall annisgwyl yn waitpid() (%s)Tag annisgwyl '%s' o fewn '%s'Tag annisgwyl '%s'; disgwyliwyd y tag '%s'Gwall anhysbys wrth weithredu proses blentyn "%s"Opsiwn anhysbys %sFath anhysbysDyfynnod heb ei gydweddu mewn llinell orchymyn neu destun arall wedi ei gragen-ddyfynnuHeb enwDefnydd:Ni ddarganfuwyd ffeil allwedd ddilys yn y plygellau dataNi ellir darllen '%s' fel gwerth Boole.Ni ellir darllen y gwerth '%s' fel rhif arnawf.Ni ellir darllen y gwerth '%s' fel rhif.Nifer anghywir o docynnau (%d)[OPSIWN...]\ ar diwedd patrwm\c ar ddiwedd patrwmEbrChwIonGorMehMawMaiGweLluSadSulIauMawMerdydy cyfeiriadau yn ôl fel amodau heb cynhaliaeth ar gyfer cydweddu rhannolwedi cyrraedd terfan ciliogorlif côdgwrthrych wedi'i lygrudisgwyl digidwedi methu cael cofEbrillChwefrorIonawrGorffennafMehefinMawrthMaiGwenerLlunSadwrnSulIauMawrthMercheryn disgwyl digid hexyn disgwyl digid hex neu '}'gwall mewnolgwall mewnol neu gwrthrych wedi'i lygru) ar goll ar ôl sylw) terfynol ar goll] terfynol ar goll ar gyfer y dosbarth noddim byd i ailadroddgwerth octal yn fwy na \377allan o gofwedi cyrraedd cyfyngiad ymgylchugall yr alwad aliadroddus ailadrodd heb derfynmynegiad rheolaidd yn rhy fawrni chaniateir ailadrodd grŵp DEFINEmae'r patrwm yn cynnwys eitemau na chynhelir ar gyfer cydweddu rhannolailadroddiad anisgwylenw dosbarth POSIX anhysbysgwall anhysbysnod anhysbys ar ôl (?nod anhysbys ar ôl (?<nod anhysbys ar ôl (?Pmae nod anhysbys yn dilyn \LC_MESSAGES/iso_3166-3.mo000064400000005266152343356400010315 0ustar00 +)*:/W )9IX m z! ) 5 N o2{)r#,319 KYo$#   - 1= o   $ /  ! : 2D +w       British Antarctic TerritoryBurma, Socialist Republic of the Union ofByelorussian SSR Soviet Socialist RepublicCanton and Enderbury IslandsCzechoslovakia, Czechoslovak Socialist RepublicDahomeyDronning Maud LandEast TimorFrance, MetropolitanFrench Afars and IssasFrench Southern and Antarctic TerritoriesGerman Democratic RepublicGilbert and Ellice IslandsJohnston IslandMidway IslandsNetherlands AntillesNeutral ZoneNew HebridesPacific Islands (trust territory)Panama Canal ZoneSerbia and MontenegroSikkimSouthern RhodesiaUS Miscellaneous Pacific IslandsUSSR, Union of Soviet Socialist RepublicsUpper Volta, Republic ofViet-Nam, Democratic Republic ofWake IslandYemen, Democratic, People's Democratic Republic ofYugoslavia, Socialist Federal Republic ofZaire, Republic ofProject-Id-Version: iso_3166-3 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2013-03-04 10:54-0000 Last-Translator: Dafydd Tomos Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: Poedit 1.5.4 Tiriogaeth Antarctig PrydainBurma, Gweriniaeth Sosialaidd UndebGweriniaeth Sosialaidd Sofiet SSR BelorussiaYnysoedd Canton ac EnderburyTsiecoslofacia, Gweriniaeth Sosialaidd TsiecoslofacDahomeyTir Dronning MaudDwyrain TimorFfrainc, MetropolitanAfars a Issas FfrengigTiroedd Deheuol ac Antarctig FfraincGweriniaeth Ddemocrataidd yr AlmaenYnysoedd Gilbert a ElliceYnys JohnstonYnysoedd MidwayAntilles yr IseldiroeddParth NiwtralHebrides NewyddYnysoedd y Cefnfor Tawel (tiriogaeth ymddiriedol)Parth Camlas PanamaSerbia a MontenegroSikkimDe RhodesiaYnysoedd amrywiol UD y Cefnfor TawelUndeb Gweriniaethau Sofietaidd Sosialaidd, USSRVolta Uchaf, GweriniaethFietnam, Gweriniaeth DemocrataiddYnys WakeYemen, Democrataidd, Gweriniaeth Democrataidd PoblIwgoslafia, Gweriniaeth Ffederal SosialaiddZaire, GweriniaethLC_MESSAGES/passwd.mo000064400000000745152343356400010202 0ustar00$,89Project-Id-Version: passwd Report-Msgid-Bugs-To: http://bugzilla.redhat.com/ POT-Creation-Date: 2018-04-01 02:30+0200 PO-Revision-Date: 2011-11-28 13:42+0000 Last-Translator: FULL NAME Language-Team: LANGUAGE Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3 LC_MESSAGES/gtk20.mo000064400000174412152343356400007633 0ustar00L|8pKFqK"K"K,K+L DLQL WLbL iL tL~L L7L)L4M=EMMMMMM'M$M(N)?NiN rN }N"N#N!N0N %O 1O9Q `Q"Q(Q*Q-Q,&R,SRR'R/RR S)S 1SRS YSVdSSQTZT`T pT |T T T"T TTTTU UU'U6UOUmUUU*V)IV+sVVV!V)VW7W$MWrW1W-WW!X)X"=X+`X#X&X.X*Y,1Y#^YYY6YYZ ZbRb XbbbkbbbbbBbNb0Lc.}c&c cccd d;dXd"`ddddddd d e"e%7e]e-weeeee"e !f"Bfhef7fg g$g.@g$og*gOg%h/5h-eheh%hrii i iiii jj9jUj ljyjJjOj2k 6kBk2GkHzkkkk ll%l-lJlSlWl_lxlllll>l$/m,Tmmmmmm mm mmm+m$n>nYnhn#qnn-nhn=oBo ^olo2o"o"o#o# p&Dpkpp pp p p p p pq q=q \qhq q/qqqQqV3r!r r&r-r4"s2Wss ssssss s s s t t t)t=t Dt Qt]tdtmt t!t t t ttt t t uu'u7u Gu+Su*uuuuvv6vA~\~n~~~~~~~~ 6HZo/ARlـ &Dd  :W r~>"ւ!6K`uу'#?Ul6ewKDKp*,LG!(Jeg6E:7 P ^'i*-C). X y ċՋ$!(+J0v3 ی(, >"_,+ !!C"^GÎ2 >P W c%m Ώޏ%)Aktk.DI[ cn}  ɑґ ّ  !:A JU\ co t  ˒ Ӓ ޒ &/ 7DU fs{ ѓݓ " .39VmĔɔ,EZnԕ,AVlƖۖ )AYq—ӗ&>V o} ʘ ژ &:JZjz Ιޙ .< P ^ l zК   ) 7E Yg x  ͛ ۛ  $2 C Q_}М/OevÝ؝&ATp˞ڞ2Ok}ϟߟ)<Oc}Ǡޠ & = JW fsա"$7Jc}Ȣ,E*eϣ1Ih@&G&n.Ħ ֦ &+8R!-Bۧ " /;C-V(68 " -!;#]!7۩ D;4p ,39*A3l «ӫܫ /B#`#(-Ѭ;-;-i$+ح%-*X"_ a Ư ˯ ֯  $ 0<O is {̰./ɱ3-?Zs"/*0[m1$)5?)u2!Ҵ),Vl  ͵*ٵ' B L Ye"n+ )ɶ()++U5&Ƿ"!"8[,q&ո)&$:+_#*̹%-JMS#źN/CJb&Ի# ?`}$!ڼ:3:n'Ƚ,0NTd0|žξ ޾  K;Z86?R !!# .*:%e"+$%J(c/6,'E2m )h8T3@+1F\x/./4qd#rm  @[j]T;@PFYT!-OV^g-=K6:  "7Tc w=,#=&Ls0v1"5 XeB~)+++C1o''  ) IT ]Lk>FJWjW$%?2e9;: IT ep    8 DQ`hq ! # @Ke};6,$1Vu!F'(Db{0$  +2LT hrx &+&R!yQ *?Unv{64+ 3> E PZasy    %/5=FNV[ahp w      0 8DLP_ek r }     &2:A JTZbks{ +  !?24r$-DZv)-DZp4VUJ>d#'L%"5]GS> .0:_>]77.o") L.m/1 5 &A$h%.)$=!Ln+#J -V ';$U%z2; j&  1 8B\mv    $*:@Z jt    #8L U_env}  ZC4x    *06<DHMP T ^ h r |  !&+05 8ELQV[`ejo r  !1A JUd|  " 2>NVfjnsw{    " <H^ o{    ' 3 > I T _ j u !6Ol!d .! =Bg[$NhUx91>AB,Hh 14 ppTUNa?0~_hv(~6g^HrL)(5zmJ53 ~TK7W)`Z"]aK / #+HJp?SoAP= " 8G'PO=fKoo(2'wis]j,w\%"FCG% `8kEYWb8^)qe9Nu>dS_<Z,rJ9~}>! CX#wjo{*{& sM- 3eD;3ti*@c /mlt;sIO3 0:0U&P{ GA?VDa:.}bktX>ZRuI65: qc2G2<\I)*jzf$TC y -@B'EM"7wF^xdL'. ny*Q+kh_R+ n`Mnme/Lxjtr;M;vQEmY6}[,T$4&y[fp-9Re]4VXFE5<7b n1d{giD-|c.(U1F /Xru<@+N&zIA\S|=HY}0QcVql|fC4#g%B!O#S$i%8Jv2yV\|[] :PQW`^kY?_aWR@D7qlbxvKsLZzu"%s" could not be converted to a value of type "%s" for attribute "%s""%s" is not a valid attribute name"%s" is not a valid attribute type"%s" is not a valid value for attribute "%s""Deepness" of the color.%1$s on %2$s%H:%M%s job #%d(None)(disabled)(unknown)--- No Tip ---<%s> element has invalid id "%s"<%s> element has neither a "name" nor an "id" attributeA <%s> element has already been specifiedA element can't occur before a elementA file named "%s" already exists. Do you want to replace it?A_t:About %sAcceleratorDisabledAcceleratorInvalidAdd Cover PageAdd the current folder to the bookmarksAdd the folder '%s' to the bookmarksAdd the selected folder to the BookmarksAdd the selected folders to the bookmarksAdvancedAll sheetsAmharic (EZ+)Amount of blue light in the color.Amount of green light in the color.Amount of red light in the color.Anonymous tag found and tags can not be created.ApplicationArtwork byAttribute "%s" is invalid on <%s> element in this contextAttribute "%s" repeated twice on the same <%s> elementAuto SelectAxesBMP image has bogus header dataBMP image has unsupported header sizeBad code encounteredBe_fore:Bits per channel of PNG image is invalid.Bits per channel of transformed PNG is not 8.Both "id" and "name" were found on the <%s> elementBourne Again ShellBourne ShellBrightness of the color.CLASSCOLORSC_ollateC_reateC_reditsC_urrent PageCache file created successfully. Cannot allocate TGA header memoryCannot allocate colormap entriesCannot allocate colormap structureCannot allocate memory for IOBuffer dataCannot allocate memory for IOBuffer structCannot allocate memory for TGA context structCannot allocate memory for loading PNM imageCannot allocate memory for loading XPM imageCannot allocate new pixbufCannot allocate temporary IOBuffer dataCannot change to folder because it is not localCannot read XPM colormapCannot realloc IOBuffer dataCedillaCircular table entry in GIF fileCl_earClassifiedClick the eyedropper, then click a color anywhere on your screen to select that color.Click this palette entry to make it the current color. To change this entry, drag a color swatch here or right-click it and select "Save color here."Co_nnectColorColor SelectionColor WheelColor _name:Command LineCompleting...Compressed icons are not supportedConfidentialConnect _anonymouslyConnect as u_ser:Copie_s:CopiesCopy URLCopy _Link AddressCopy _LocationCould not add a bookmarkCould not allocate memory: %sCould not clear listCould not create stream: %sCould not find the icon '%s'. The '%s' theme was not found either, perhaps you need to install it. You can get a copy from: %sCould not get image height (bad TIFF file)Could not get image width (bad TIFF file)Could not get information for file '%s': %sCould not mount %sCould not read from stream: %sCould not read the contents of %sCould not read the contents of the folderCould not remove bookmarkCould not remove itemCould not rename %s back to %s: %s. Could not rename %s to %s: %s Could not rename %s to %s: %s, removing %s then. Could not retrieve information about the fileCould not select fileCould not send the search requestCould not show linkCould not start the search processCouldn't allocate memory for context bufferCouldn't allocate memory for headerCouldn't allocate memory for line dataCouldn't allocate memory for loading JPEG fileCouldn't allocate memory for paletted dataCouldn't allocate memory for saving BMP fileCouldn't allocate memory for streamCouldn't convert filenameCouldn't create new pixbufCouldn't recognize the image file format for file '%s'Couldn't save the restCouldn't write to BMP fileCouldn't write to TIFF fileCreate Fo_lderCreate in _folder:CreditsCursor hotspot outside imageCustom Size %dCustom sizeCyrillic (Transliterated)DISPLAYDe_lete FileDelete FileDesktopDidn't get all lines of PCX imageDimensions of TIFF image too largeDisabledDo use the Wintab API [default]Documented byDon't batch GDI requestsDon't check for the existence of index.themeDon't include image data in the cacheDon't use the Wintab API for tablet supportDown PathElement <%s> is not allowed below <%s>EmptyError creating folder '%s': %sError creating print previewError deleting file '%s': %sError from StartDocError interpreting JPEG image file (%s)Error launching previewError loading icon: %sError parsing option --gdk-debugError parsing option --gdk-no-debugError printingError reading ICNS image: %sError renaming file "%s" to "%s": %sError renaming file "%s": %sError renaming file to "%s": %sError writing to image file: %sError writing to image streamEven sheetsExcess data in fileFLAGSFailed to close '%s' while writing image, all data may not have been saved: %sFailed to load RGB data from TIFF fileFailed to load TIFF imageFailed to load animation '%s': reason not known, probably a corrupt animation fileFailed to load iconFailed to load image '%s': %sFailed to load image '%s': reason not known, probably a corrupt image fileFailed to open '%s' for writing: %sFailed to open TIFF imageFailed to open file %s : %s Failed to open file '%s': %sFailed to open temporary fileFailed to read from temporary fileFailed to rewrite header Failed to save TIFF imageFailed to write TIFF dataFailed to write cache file: %s Failed to write folder index Failed to write hash table Failed to write header Failed to write to temporary file when loading XBM imageFailed to write to temporary file when loading XPM imageFailure reading GIF: %sFatal error in PNG image file: %sFatal error reading PNG image fileFatal error reading PNG image file: %sFileFile SystemFile System RootFile does not appear to be a GIF fileFile not found: %s FilesFinishingFol_dersFolder unreadable: %sFoldersFontFont SelectionForget password _immediatelyGIF file was missing some data (perhaps it was truncated somehow?)GIF image has no global colormap, and a frame inside it has no local colormap.GIF image is corrupt (incorrect LZW compression)GIF image loader cannot understand this image.GIF image was truncated or incomplete.GTK+ OptionsGTK+ debugging flags to setGTK+ debugging flags to unsetGammaGdk debugging flags to setGdk debugging flags to unsetGeneralGetting printer information failedGetting printer information...HighIPAIcon '%s' not present in themeIcon has zero heightIcon has zero widthImage QualityImage file '%s' contains no dataImage format unknownImage has invalid width and/or heightImage has unsupported bppImage has unsupported number of %d-bit planesImage has zero heightImage has zero widthImage header corruptImage pixel data corruptImage too large to be saved as ICOImage type '%s' is not supportedImage type currently not supportedImage-loading module %s does not export the proper interface; perhaps it's from a different GTK version?Incremental loading of image type '%s' is not supportedInputInput _MethodsInsufficient memory to load PNG fileInsufficient memory to load PNM context structInsufficient memory to load PNM fileInsufficient memory to load XBM image fileInsufficient memory to load image, try exiting some applications to free memoryInsufficient memory to open TIFF fileInsufficient memory to save image into a bufferInsufficient memory to save image to callbackInsufficient memory to store a %ld by %ld image; try exiting some applications to reduce memory usageInternal error in the GIF loader (%s)Internal error: Image loader module '%s' failed to complete an operation, but didn't give a reason for the failureInuktitut (Transliterated)Invalid URIInvalid UTF-8Invalid XBM fileInvalid XPM headerInvalid argument to PrintDlgExInvalid file nameInvalid handle to PrintDlgExInvalid header in animationInvalid header in iconInvalid pathInvalid pointer to PrintDlgExJPEG quality must be a value between 0 and 100; value '%d' is not allowed.JPEG quality must be a value between 0 and 100; value '%s' could not be parsed.JobJob DetailsKeysKeys for PNG text chunks must be ASCII characters.Keys for PNG text chunks must have at least 1 and at most 79 characters.LRE Left-to-right _embeddingLRM _Left-to-right markLRO Left-to-right _overrideLandscapeLayoutLicenseLoad additional GTK+ modulesLocationLowMODULESMake X calls synchronousMake all warnings fatalMalformed chunk in animationManage Custom SizesManage Custom Sizes...Margins from Printer...Margins: Left: %s %s Right: %s %s Top: %s %s Bottom: %s %sMaximum color value in PNM file is 0Maximum color value in PNM file is too largeMediumModifiedMutedNAMENameName too longNeed user interventionNew FolderNew accelerator...No XPM header foundNo deserialize function found for format %sNo extended input devicesNo item for URI '%s' foundNo items foundNo matchNo palette found at end of PCX dataNo printer foundNo recently used resource found with URI `%s'No theme index file in '%s'. If you really want to create an icon cache here, use --ignore-theme-index. NoneNot a valid icon cache: %s Not availableNot enough free memoryNot enough memory to composite a frame in GIF fileNot enough memory to load GIF fileNot enough memory to load ICO fileNot enough memory to load RAS imageNot enough memory to load animationNot enough memory to load bitmap imageNot enough memory to load iconNot enough memory to load imageOdd sheetsOn _holdOne SidedOp_acity:Open '%s'Opening %d ItemOpening %d ItemsOpening %sOther...Out of paperOutermost element in text must be not <%s>Output TrayOutput a C header fileOutput t_ray:Overwrite an existing cache, even if up to datePDFPDF _Pop directional formattingPNG compression level must be a value between 0 and 9; value '%d' is not allowed.PNG compression level must be a value between 0 and 9; value '%s' could not be parsed.PNM file has an image height of 0PNM file has an image width of 0PNM file has an incorrect initial bytePNM file is not in a recognized PNM subformatPNM image loader does not support this PNM subformatPNM loader expected to find an integer, but didn'tPage %uPage SetupPagesPages Per SheetPages per _sheet:Pages per _side:PaperPaper MarginsPaper SizePaper SourcePaper TypePaper _source:Paper _type:Path does not existPausedPick a ColorPick a FontPlacesPortraitPosition on the color wheel.PostscriptPremature end-of-file encounteredPreparingPreparing %dPri_ority:PrintPrint DocumentPrint to FilePrint to LPRPrint to Test PrinterPrinterPrinter DefaultPrinter offlinePrinting %dProgram class as used by the window managerProgram name as used by the window managerRAS image has bogus header dataRAS image has unknown typeRLE Right-to-left e_mbeddingRLM _Right-to-left markRLO Right-to-left o_verrideRangeRaw PNM formats require exactly one whitespace before sample dataRaw PNM image type is invalidReally delete file "%s"?Received invalid color data Recently UsedRemember _foreverRemember password until you _logoutRemoveRemove the bookmark '%s'Remove the selected bookmarkRename FileRename file "%s" to:Rename...SCREENSame as --no-wintabSans 12Save in _folder:Sc_ale:ScreenSe_lectionSearchSearch:SecretSelect A FileSelect the color you want from the outer ring. Select the darkness or lightness of that color using the inner triangle.Select which type of documents are shownSelect which types of files are shownSerialized data is malformedSerialized data is malformed. First section isn't GTKTEXTBUFFERCONTENTS-0001Shortcut %s already existsShortcut %s does not existShow GTK+ OptionsShow _Hidden FilesShow _Private ResourcesSi_ze:SimpleSizeSize of the palette in 8 bit modeSole completionSome of the settings in the dialog conflictSpecify one or more page ranges, e.g. 1-3,7,11Stack overflowStandardStarting %sStatusStock labelBest _FitStock labelC_onnectStock labelCu_tStock labelDecrease IndentStock labelErrorStock labelFind and _ReplaceStock labelIncrease IndentStock labelInformationStock labelLandscapeStock labelPortraitStock labelPrint Pre_viewStock labelQuestionStock labelSave _AsStock labelSelect _AllStock labelWarningStock labelZoom _InStock labelZoom _OutStock label_AboutStock label_AddStock label_ApplyStock label_AscendingStock label_BoldStock label_CD-RomStock label_CancelStock label_CenterStock label_ClearStock label_CloseStock label_ColorStock label_ConvertStock label_CopyStock label_DeleteStock label_DescendingStock label_DiscardStock label_DisconnectStock label_EditStock label_ExecuteStock label_FillStock label_FloppyStock label_FontStock label_FullscreenStock label_HarddiskStock label_HelpStock label_HomeStock label_IndexStock label_InformationStock label_ItalicStock label_Jump toStock label_Leave FullscreenStock label_LeftStock label_NetworkStock label_NewStock label_NoStock label_Normal SizeStock label_OKStock label_OpenStock label_PasteStock label_PreferencesStock label_PrintStock label_PropertiesStock label_QuitStock label_RedoStock label_RefreshStock label_RemoveStock label_RevertStock label_RightStock label_SaveStock label_Spell CheckStock label_StopStock label_StrikethroughStock label_UndeleteStock label_UnderlineStock label_UndoStock label_YesStock label, mediaP_auseStock label, mediaPre_viousStock label, mediaR_ewindStock label, media_ForwardStock label, media_NextStock label, media_PlayStock label, media_RecordStock label, media_StopStock label, navigation_BackStock label, navigation_BottomStock label, navigation_DownStock label, navigation_FirstStock label, navigation_ForwardStock label, navigation_LastStock label, navigation_TopStock label, navigation_UpTGA image has invalid dimensionsTGA image type not supportedTIFFClose operation failedT_wo-sided:Tag "%s" already definedTag "%s" does not exist in buffer and tags can not be created.Tag "%s" has invalid priority "%s"Tag "%s" has not been defined.Thai-LaoThe ANI image formatThe BMP image formatThe EMF image formatThe GIF image formatThe ICNS image formatThe ICO image formatThe JPEG 2000 image formatThe JPEG image formatThe PCX image formatThe PNG image formatThe PNM/PBM/PGM/PPM image format familyThe Sun raster image formatThe TIFF image formatThe Targa image formatThe WBMP image formatThe WMF image formatThe XBM image formatThe XPM image formatThe attribute "%s" was found twice on the <%s> elementThe color you've chosen.The color you've chosen. You can drag this color to a palette entry to save it for use in the future.The file "%s" resides on another machine (called %s) and may not be available to this program. Are you sure that you want to select it?The file already exists in "%s". Replacing it will overwrite its contents.The filename "%s" contains symbols that are not allowed in filenamesThe filename "%s" couldn't be converted to UTF-8. (try setting the environment variable G_FILENAME_ENCODING): %sThe folder contents could not be displayedThe folder could not be createdThe folder could not be created, as a file with the same name already exists. Try using a different name for the folder, or rename the file first.The folder name "%s" contains symbols that are not allowed in filenamesThe generated cache was invalid. The license of the programThe previously-selected color, for comparison to the color you're selecting now. You can drag this color to a palette entry, or select this color as current by dragging it to the other color swatch alongside.The program was not able to create a connection to the indexer daemon. Please make sure it is running.This build of gdk-pixbuf does not support saving the image format: %sThis function is not implemented for widgets of class '%s'Tigrigna-Eritrean (EZ+)Tigrigna-Ethiopian (EZ+)Time of printTop SecretTopdown BMP images cannot be compressedTransformed JPEG has zero width or height.Transformed JPEG2000 has zero width or heightTransformed PNG has unsupported number of channels, must be 3 or 4.Transformed PNG has zero width or height.Transformed PNG not RGB or RGBA.Translated byTransparency of the color.Turn off verbose outputTwo SidedType a file nameType name of new folderUnable to end processUnable to find an item with URI '%s'Unable to find include file: "%s"Unable to load image-loading module: %s: %sUnable to locate image file in pixmap_path: "%s"Unable to locate theme engine in module_path: "%s",UnclassifiedUnexpected bitdepth for colormap entriesUnexpected character data on line %d char %dUnexpected end of PNM image dataUnexpected icon chunk in animationUnexpected start tag '%s' on line %d char %dUnknownUnknown error when trying to deserialize %sUnknown itemUnrecognized image file formatUnspecified errorUnsupported JPEG color space (%s)Unsupported animation typeUnsupported depth for ICO file: %dUnsupported icon typeUp PathUrgentValidate existing icon cacheValue for PNG text chunk %s cannot be converted to ISO-8859-1 encoding.Version %s of the GIF file format is not supportedVietnamese (VIQR)VolumeVolume DownVolume UpWidth or height of TIFF image is zeroWindowWritten byX Input MethodX _tilt:X display to useX screen to useXPM file has image height <= 0XPM file has image width <= 0XPM file has invalid number of colorsXPM has invalid number of chars per pixelY t_ilt:Yesterday at %H:%MYou can enter an HTML-style hexadecimal color value, or simply a color name such as 'orange' in this entry.Z ShellZWJ Zero width _joinerZWNJ Zero width _non-joinerZWS _Zero width space_Add_Add to Bookmarks_After:_All Pages_Billing info:_Blue:_Bottom:_Browse for other folders_Clear List_Device:_End Process_Family:_Files_Folder name:_Format for:_Gamma value_Green:_Height:_Hue:_Insert Unicode Control Character_Left:_License_Location:_Mode:_Name:_New Folder_Now_Only print:_Open Link_Orientation:_Output format_Palette:_Paper size:_Password:_Places_Pressure:_Preview:_Red:_Remove_Remove From List_Rename_Rename File_Replace_Reverse_Right:_Saturation:_Save color here_Save in folder:_Selection: _Style:_Top:_Value:_Wheel:_Width:_X:_Y:abcdefghijk ABCDEFGHIJKcalendar year format%Ycalendar:MYcalendar:day:digits%dcalendar:week:digits%dcalendar:week_start:0default:LTRdefault:mmdifferent idatas found for symlinked '%s' and '%s' failed to allocate image buffer of %u bytefailed to allocate image buffer of %u bytesinchinput method menuSysteminput method menuSystem (%s)keyboard labelAltkeyboard labelBackSpacekeyboard labelBackslashkeyboard labelBeginkeyboard labelCtrlkeyboard labelDownkeyboard labelEndkeyboard labelHomekeyboard labelHyperkeyboard labelInsertkeyboard labelLeftkeyboard labelMetakeyboard labelPage_Downkeyboard labelPage_Upkeyboard labelPausekeyboard labelPrintkeyboard labelReturnkeyboard labelRightkeyboard labelScroll_Lockkeyboard labelShiftkeyboard labelSpacekeyboard labelSuperkeyboard labelSys_Reqkeyboard labelTabkeyboard labelUpmmnoneoutput.%spaper size#10 Envelopepaper size#11 Envelopepaper size#12 Envelopepaper size#14 Envelopepaper size#9 Envelopepaper size10x11paper size10x13paper size10x14paper size10x15paper size11x12paper size11x15paper size12x19paper size5x7paper size6x9 Envelopepaper size7x9 Envelopepaper size9x11 Envelopepaper sizeA0paper sizeA0x2paper sizeA0x3paper sizeA1paper sizeA10paper sizeA1x3paper sizeA1x4paper sizeA2paper sizeA2x3paper sizeA2x4paper sizeA2x5paper sizeA3paper sizeA3 Extrapaper sizeA3x3paper sizeA3x4paper sizeA3x5paper sizeA3x6paper sizeA3x7paper sizeA4paper sizeA4 Extrapaper sizeA4 Tabpaper sizeA4x3paper sizeA4x4paper sizeA4x5paper sizeA4x6paper sizeA4x7paper sizeA4x8paper sizeA4x9paper sizeA5paper sizeA5 Extrapaper sizeA6paper sizeA7paper sizeA8paper sizeA9paper sizeArch Apaper sizeArch Bpaper sizeArch Cpaper sizeArch Dpaper sizeArch Epaper sizeB0paper sizeB1paper sizeB10paper sizeB2paper sizeB3paper sizeB4paper sizeB5paper sizeB5 Extrapaper sizeB6paper sizeB6/C4paper sizeB7paper sizeB8paper sizeB9paper sizeC0paper sizeC1paper sizeC10paper sizeC2paper sizeC3paper sizeC4paper sizeC5paper sizeC6paper sizeC6/C5paper sizeC7paper sizeC7/C6paper sizeC8paper sizeC9paper sizeChoukei 2 Envelopepaper sizeChoukei 3 Envelopepaper sizeChoukei 4 Envelopepaper sizeDL Envelopepaper sizeDai-pa-kaipaper sizeEuropean edppaper sizeExecutivepaper sizeFanFold Europeanpaper sizeFanFold German Legalpaper sizeFanFold USpaper sizeFoliopaper sizeFolio sppaper sizeGovernment Legalpaper sizeGovernment Letterpaper sizeIndex 3x5paper sizeIndex 4x6 (postcard)paper sizeIndex 4x6 extpaper sizeIndex 5x8paper sizeInvite Envelopepaper sizeInvoicepaper sizeItalian Envelopepaper sizeJB0paper sizeJB1paper sizeJB10paper sizeJB2paper sizeJB3paper sizeJB4paper sizeJB5paper sizeJB6paper sizeJB7paper sizeJB8paper sizeJB9paper sizeMonarch Envelopepaper sizePersonal Envelopepaper sizePostfix Envelopepaper sizeQuartopaper sizeRA0paper sizeRA1paper sizeRA2paper sizeROC 16kpaper sizeROC 8kpaper sizeSRA0paper sizeSRA1paper sizeSRA2paper sizeSmall Photopaper sizeSuper Apaper sizeSuper Bpaper sizeTabloidpaper sizeUS Legalpaper sizeUS Legal Extrapaper sizeUS Letterpaper sizeUS Letter Extrapaper sizeUS Letter Pluspaper sizeWide Formatpaper sizea2 Envelopepaper sizeasme_fpaper sizeb-pluspaper sizecpaper sizec5 Envelopepaper sizedpaper sizeepaper sizeedppaper sizefpaper sizehagaki (postcard)paper sizejis execpaper sizejuuro-ku-kaipaper sizekahu Envelopepaper sizekaku2 Envelopepaper sizeoufuku (reply postcard)paper sizepa-kaipaper sizeprc 16kpaper sizeprc 32kpaper sizeprc1 Envelopepaper sizeprc10 Envelopepaper sizeprc2 Envelopepaper sizeprc3 Envelopepaper sizeprc4 Envelopepaper sizeprc5 Envelopepaper sizeprc6 Envelopepaper sizeprc7 Envelopepaper sizeprc8 Envelopepaper sizeyou4 Envelopeprint operation statusFinishedprint operation statusFinished with errorprint operation statusPrintingprint operation statusWaitingprogress bar label%d %%recent menu label_%d. %stest-output.%sunsupported RAS image variationvolume percentage%d %%year measurement template2000Project-Id-Version: gtk+ Report-Msgid-Bugs-To: POT-Creation-Date: 2010-06-10 11:56-0400 PO-Revision-Date: 2009-12-24 23:10+0100 Last-Translator: Iestyn Pryce Language-Team: Cymraeg MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Language: cy Plural-Forms: nplurals=2; plural=(n==2) ? 1 : 0; X-Generator: Virtaal 0.5.0 Methu trosi "%s" i werth o'r math "%s" ar gyfer y briodwedd "%s"Nid yw "%s" yn enw dilys ar briodoleddNid yw "%s" yn fath dilys o briodoleddNid yw "%s" yn werth dilys i'r briodoledd "%s""Dyfnder" y lliw.%1$s ar %2$s%H:%M%s gorchwyl #%d(Dim)(analluogwyd)(anhysbys)--- Dim Cyngor ---Mae gan yr elfen <%s> id annilys: "%s"Does gan yr elfen <%s> mo'r elfen "name" na "id" chwaithElfen <%s> eisoes wedi ei phenodiNi all elfen ddigwydd cyn elfen Mae ffeil o'r enw "%s" eisoes yn bodoli. Ydych chi am ei hamnewid?_I:Ynglyn â %sAnalluogwydAnnilysCreu Tudalen GlawrYchwanegu'r blygell bresennol at y llyfrnodauYchwanegu'r blygell '%s' at y llyfrnodauYchwanegu'r blygell sydd wedi ei dewis at y LlyfrnodauYchwanegu'r plygellau sydd wedi eu dewis at y llyfrnodauUwchPob taflenAmharig (EZ+)Faint o olau glas sydd yn y lliw.Faint o olau gwyrdd sydd yn y lliw.Faint o olau coch sydd yn y lliw.Tag anhysbys wedi ei ganfod, felly'n methu creu tagiau.RhaglenGraffeg ganMae'r briodwedd "%s" yn annilys ar yr elfen <%s> yn y cyd-destun hwnMae'r briodwedd "%s" wedi ei ail-adrodd ar yr un elfen <%s>Dewis yn AwtomatigEchelinauMae gan y ddelwedd BMP ddata pennawd sothachMae gan y ddelwedd BMP pennawd o faint ni chynhelirCanfuwyd cod gwael_Cyn:Mae nifer y didau i bob sianel y ddelwedd PNG yn annilys.Nid oes 8 did i bob sianel y ddelwedd PNG.Canfuwyd "id" yn ogystal â "name" ar yr elfen <%s>Cragen Bourne AgainCragen BourneGloywder y lliw.DOSBARTHLLIWIAU_Coladu_Creu_DiolchiadauT_udalen BresennolFfeil storfa wedi'i chynhyrchu'n llwyddiannus. Methu dyrannu cof pennawd TGAMethu dyrannu cofnodion map lliwiauMethu dyrannu strwythur map lliwiauMethu dyrannu cof ar gyfer data IOBufferMethu dyrannu cof ar gyfer strwythur IOBufferMethu dyrannu cof ar gyfer strwythur cyd-destun delwedd TGAMethu dyrannu cof er mwyn llwytho delwedd PNMMethu dyrannu cof er mwyn llwytho delwedd XPMMethu dyrannu pixbuf newyddMethu dyrannu data IOBuffer dros droMethwyd newid i'r blygell am nad yw'n lleolMethu darllen map lliwiau delwedd XPMMethu ail-ddyrannu cof ar gyfer data IOBufferSedilaCofnod cylchol mewn tabl ffeil GIF_ClirioDosbartholClicwch y dewiswr lliw, yna cliciwch ar liw unrhywle ar eich sgrîn er mwyn dewis y lliw hwnnw.Cliciwch y cofnod palet yma er mwyn ei ddefnyddio fel y lliw cyfredol. Er mwyn newid y cofnod yma, llusgwch sampl lliw yma neu cliciwch arni gyda botwm dde'r llygoden a dewis "Cadw'r lliw fan hyn"_CysylltuLliwDewis LliwOlwyn Lliw_Enw lliw:Llinell OrchymynYn cwblhau...Ni chynhelir eiconau wedi eu cywasguCyfrinacholCysylltu'n _ddienwCysylltu fel d_efnyddiwr:Copï_au:CopïauCopïo LAUCopïo Cyfeiriad Cysw_lltCopïo _LleoliadMethwyd ychwanegu llyfrnodMethwyd dyrannu cof: %sMethu clirio'r rhestrMethu creu cyfeiriadur: %sMethwyd canfod yr eicon '%s'. Ddarganfyddwyd mo'r thema '%s' chwaith; hwyrach bydd rhaid i chi ei ail-osod. Gellwch gael copi o: %sMethu canfod hyd y ddelwedd (ffeil TIFF ddrwg)Methu canfod lled y ddelwedd (ffeil TIFF ddrwg)Methwyd cyrchu gwybodaeth ar gyfer y ffeil '%s': %sMethu â gosod %sMethu darllen o'r llif: %sMethu darllen cynnwys %sMethu darllen cynnwys y plygellMethwyd dileu'r llyfrnodMethu tynnu'r eitemMethu ail-enwi %s yn ôl i %s: %s Methu ail-enwi %s yn %s: %s Methu ail-enwi %s yn %s: %s, felly'n tynnu %s. Methwyd cyrchu gwybodaeth ynghylch y ffeilMethu dewis ffeilMethu anfon y cais chwilioMethwyd dangos cyswlltMethu cychwyn y broses chwilioMethwyd dyrannu cof ar gyfer strwythur cyd-destunMethwyd dyrannu cof ar gyfer pennawdMethwyd dyrannu cof ar gyfer data llinellMethu canfod digon o gof er mwyn llwytho'r ffeil JPEGMethwyd dyrannu cof ar gyfer data paletigMethu dyrannu digon o gof er mwyn cadw'r ffeil BMPMethwyd dyrannu cof ar gyfer llifMethu trawsnewid enw y ffeilMethwyd creu pixbuf newyddMethu canfod fformat delwedd y ffeil '%s'Methu cadw'r gweddillMethu ysgrifennu i'r ffeil BMPMethu ysgrifennu i'r ffeil TIFFCreu _PlygellCreu mewn _plygell:DiolchiadauMan poeth cyrchydd y tu allan i'r ddelweddMaint Addasedig %dMaint addasedigCyrilig (Trawslythrenedig)DANGOSYDD_Dileu FfeilDileu FfeilPenbwrddNi chafwyd pob llinell delwedd PCXMae dimensiynau'r ddelwedd TIFF yn rhy fawrAnalluogwydDefnyddio API Wintab [dewis rhagosodedig]Dogfennwyd ganPeidio â thrin ceisiadau GDI fel pentwrPeidio â gwirio am fodolaeth index.themePeidio â chynnwys data delwedd yn y storfaPeidio â defnyddio API Wintab er mwyn cynnal tablediI Lawr y LlwybrNi chaniateir yr elfen <%s> islaw <%s>GwagGwall wrth greu'r plygell '%s': %sGwall wrth creu rhagolwg argraffuGwall wrth ddileu'r ffeil '%s': %sGwall o fewn StartDocGwall wrth ddehongli ffeil delwedd JPEG (%s)Gwall wrth lansio rhagolwgGwall wrth lwytho eicon: %sGwall wrth ramadegu opsiwn --gdk-debugGwall wrth ramadegu opsiwn --gdk-no-debugGwall wrth argraffuGwall wrth ddarllen delwedd ICNS: %sGwall wrth ailenwi'r ffeil "%s" at "%s": %sGwall ailenwi ffeil "%s": %sGwall wrth ailenwi ffeil i "%s": %sGwall wrth ysgrifennu at ffeil delwedd: %sGwall wrth ysgrifennu at llif delweddTaflenni eilrifGormodedd o ddata mewn ffeilOPSIYNAUMethu cau '%s' wrth ysgrifennu delwedd, efallai ni arbedwyd yr holl ddata: %sMethu llwytho data RGB o ffeil TIFFMethu llwytho delwedd TIFFMethu llwytho animeiddiad '%s': rheswm anhysbys, ffeil llygredig mwy na thebygMethu llwytho eiconMethu llwytho delwedd '%s': %sMethu llwytho delwedd '%s': rheswm anhysbys, ffeil llygredig mwy na thebygMethu agor '%s' er mwyn ysgrifennu: %sMethu agor delwedd TIFFMethu agor y ffeil %s: %s Methu agor y ffeil '%s': %sMethwyd agor ffeil dros droMethwyd darllen o ffeil dros droMethu ail-ysgrifennu pennyn Methu cadw'r ddelwedd TIFFMethu ysgrifennu'r data TIFFMethu ysgrifennu'r ffeil storfa: %s Methu ysgrifennu mynegai ffolder Methu ysgrifennu tabl stwnsh Methu ysgrifennu pennyn Methu ysgrifennu at ffeil dros dro wrth lwytho delwedd XBMMethu ysgrifennu at ffeil dros dro wrth lwytho delwedd XPMMethiant wrth ddarllen GIF: %sGwall marwol yn y ffeil delwedd PNG: %sGwall marwol wrth ddarllen ffeil delwedd PNGGwall marwol wrth ddarllen ffeil delwedd PNG: %sFfeilSystem FfeiliauGwraidd System FfeiliauMae'n ymddangos mai nad ffeil GIF yw'r ffeil hwnMethu canfod ffeil: %s FfeiliauWrthi'n gorffen_PlygellauPlygell annarllenadwy: %sPlygellauFfontDewis FfontAnghofio cyfrinair yn _sythRoedd peth data ar goll o'r ffeil GIF (efallai cafodd ei dalfyrru rhywsut?)Doedd dim map lliwiau gan y ddelwedd GIF, ac roedd yn cynnwys ffrâm heb fap lliwiau lleolMae'r ddelwedd GIF yn llygredig (cywasgiad LZW anghywir)Nid yw'r llwythwr delwedd GIF yn deall y ddelwedd hon.Roedd y ddelwedd GIF yn anghyflawn neu wedi gorffen yn rhy fuanOpsiynau GTK+Opsiynau datnamu GTK+ i'w gosodOpsiynau datnamu GTK+ i'w dadosodGammaPa opsiynau datnamu Gdk i'w gosodPa opsiynau datnamu Gdk i'w dadosodCyffredinolMethwyd ymofyn gwybodaeth am yr argraffyddYmofyn gwybodaeth am yr argraffydd...UchelY Wyddor Ffonetig Ryngwladol (IPA)Nid yw'r eicon '%s' yn bresennol yn y themaMae gan yr eicon hyd seroMae gan yr eicon lled seroAnsawdd DelweddFfeil ddelwedd '%s' heb gynnwys dataFformat delwedd anhysbysMae gan y ddelwedd hyd a/neu led annilysMae gan y ddelwedd ddyfnder picsel ni chynhelirMae gan y ddelwedd nifer o blaenau %d did ni chynhelirMae gan y ddelwedd hyd seroMae gan y ddelwedd lled seroPennawd delwedd lygredigMae data picseli'r ddelwedd wedi llygruMae'r ddelwedd yn rhy fawr i gael ei chadw fel ICONi chynhelir y math delwedd '%s'Ni chynhelir y math delwedd ar hyn o brydNid yw'r modiwl llwytho delweddau %s yn darparu'r rhyngwyneb cywir; efallai ei fod o fersiwn arall o GTKNi chynhelir llwytho delweddau o'r math '%s' yn gynyddolMewnbwnModdau _MewnbwnDim digon o gof er mwyn llwytho'r ffeil delwedd PNGDim digon o gof er mwyn llwytho strwythur cyd-destun delwedd PNMDim digon o gof er mwyn llwytho delwedd PNMDim digon o gof er mwyn llwytho ddeil delwedd XBMDim digon o gof er mwyn llwytho'r ddelwedd, ceisiwch gau rhai rhaglenni er mwyn rhyddhau cofDim digon o gof er mwyn agor ffeil delwedd TIFFDim digon o gof er mwyn cadw delwedd at fyfferDim digon o gof er mwyn cadw delwedd at adalwadDim digon o gof er mwyn llwytho delwedd o faint %ld gan %ld; ceisiwch derfynu rhai rhaglenni er mwyn rhyddhau cofGwall mewnol yn y llwythwr GIF (%s)Gwall mewnol: fe fethodd y modiwl llwytho delweddau '%s' gwblhau'r weithred, ond ni ddarparodd reswm am y methiantInuktitut (Trawslythrenedig)URI annilysUTF-8 AnnilysFfeil ddelwedd XBM annilysFfeil delwedd XPM annilysArg annilys i PrintDlgExEnw ffeil annilysDolen annilys i PrintDlgExPennawd annilys mewn animeiddiadPennawd annilys mewn eiconLlwybr annilysPwyntydd annilys i PrintDlgExMae'n rhaid i ansawdd delweddau JPEG fod yn werth rhwng 0 a 100; ni chaniateir y gwerth '%d'.Mae'n rhaid i'r ansawdd JPEG fod yn rhif rhwng 0 a 100; methu adnabod y gwerth '%s'.TasgManylion y DasgBysellauDim ond nodau ASCII fedr fod mewn allweddau talp testun delweddau PNG.Mae'n rhaid bod gan allweddau testun delweddau PNG o leiaf un ac o fwyaf 79 o nodau.LRE _Ymgorffori chwith-i'r-ddeLRM Mark _chwith-i'r-ddeLRO _Gwrthweithred chwith-i'r-ddeTirlunCynllunTrwyddedLlwytho modylau GTK+ ychwanegolLleoliadIselMODYLAUGwneud galwadau X yn gydamserolGwneud pob gwall yn farwolDarn annilys mewn animeiddiadTrefnu Meintiau AddasedigTrefnu Meintiau Addasedig...Cael Ymylon o'r Argraffydd...Ymylon: Chwith: %s %s De: %s %s Top: %s %s Gwaelod: %s %sMae'r gwerth lliw uchaf yn y ffeil delwedd PNM yn seroMae'r gwerth lliw uchaf yn y ffeil delwedd PNM yn rhy fawrCanoligWedi newidWedi'i FudoENWEnwMae'r enw yn rhy hirAngen i'r defnyddiwr ymyrrydPlygell NewyddCyflymydd newydd...Ni chanfuwyd pennawd delwedd XPMDim ffwythiant dad-gyfresu wedi ei ganfod ar gyfer y ffurf %sDim dyfeisiau mewnbwn estynedigDim eitem wedi'i ganfod ar gyfer yr URI '%s'Dim eitemau wedi'u canfodDim cydweddiadNi chanfuwyd palet ar ddiwedd data PCXHeb ganfod argraffyddHeb ddefnyddio adnodd yn ddiweddar â'r URI `%s'Dim ffeil fynegai themâu yn '%s'. Os ydych chi wir am greu storfa eiconau fan yna, defnyddiwch --ignore-theme-index. DimDdim yn storfa eiconau ddilys: %s Ddim ar gaelDim digon o gof yn rhyddDim digon o gof er mwyn gwneud ffrâm yn gyfansawdd yn y ffeil GIFDim digon o gof er mwyn llwytho ffeil GIFDim digon o gof er mwyn llwytho'r ffeil ICODim digon o gof er mwyn llwytho delwedd RASDim digon o gof er mwyn llwytho animeiddiadDim digon o gof er mwyn llwytho'r ddelwedd didfapDim digon o gof er mwyn llwytho'r eiconDim digon o gof er mwyn llwytho delweddTaflenni odrifAr _saibUn Ochr_Didreiddedd:Agor '%s'Agor %d EitemAgor %d o EitemauYn agor %sArall...Allan o bapurRhaid i'r elfen bellaf allan yn y testun fod yn , nid <%s>Lleoliad Terfynol y PapurCynhyrchu ffeil bennyn CLleoliad t_erfynol y papur:Trosysgrifo'r storfa sy'n bodoli, hyd yn oed os yw hi'n gyfoesPDFPDF _Popio fformadu cyfeiriadolMae'n rhaid i lefel cywasgu'r PNG fod yn rhif rhwng 0 a 9; ni chaniateir y gwerth '%d'.Mae'n rhaid i lefel cywasgu'r PNG fod yn rhif rhwng 0 a 9; methu adnabod y gwerth '%s'.Mae gan y ffeil delwedd PNM hyd seroMae gan y ffeil delwedd PNM lled seroMae gan y ffeil delwedd PNM feit dechreuol annilysNid yw'r ffeil delwedd PNM mewn is-ffurf PNM a adnabyddirNid yw'r llwythwr delweddau PNM yn cynnal y fformat PNM ymaRoedd y llwythwr PNM yn disgwyl cyfanrif, ond chafwyd ddimTudalen %uGosodiad TudalenTudalennauNifer o Dudalennau'r DdalenTudalennau i bob _dalen:Tudalennau ar bob _ochr:PapurYmylon PapurMaint PapurFfynhonnell y PapurMath y Papur_Ffynhonnell papur:_Math papur:Nid yw'r lwybr yn bodoliWedi seibioDewiswch LiwDewiswch FfontLlefyddPortreadLleoliad ar yr olwyn lliw.PostscriptCanfuwyd diwedd ffeil yn rhy fuanWrthi'n paratoiWrthi'n paratoi %d_Blaenoriaeth:ArgraffuArgraffu DogfenArgraffu i FfeilPrintio i LPRArgraffu ar Argraffydd PrawfArgraffyddRhagosodiad yr ArgraffyddArgraffydd ddim ar-leinWrthi'n argraffu %dDosbarth y rhaglen fel a ddefnyddir gan y rheolwr ffenestriEnw'r rhaglen fel a ddefnyddir gan y rheolwr ffenestriMae gan y ddelwedd RAS ddata pennawd annilysMae gan y ddelwedd RAS fath anhysbysRLE Y_mgorffori dde-i'r-chwithRLM Marc _dde-i'r-chwithRLO G_wrthweithred dde-i'r-chwithAmrediadMae fformatau PNM crai yn mynnu un nod gofod yn union cyn data samplauMae math y ddelwedd PNG crau yn annilysDileu'r ffeil "%s" go iawn?Derbyniwyd data lliw annilys Defnyddiwyd yn DdiweddarCofio am _bythCofio cyfrinair am y tan eich bod yn a_llgofnodiTynnuTynnu'r llyfrnod '%s'Dileu'r llyfrnod sydd wedi ei ddewisAilenwi FfeilAilenwi Ffeil "%s" i:Ailenwi...SGRÎNYr un peth â --no-wintabSans 12Cadw mewn _plygell:_Graddfa:Sgrin_Dewis: ChwilioChwilio:CyfrinachDewiswch FfeilDewiswch y lliw rydych ei eisiau o'r cylch allanol. Dewiswch tywyllwch neu oleuni y lliw hwnnw gan ddefnyddio'r triongl mewnol.Dewis pa fath o ddogfennau a ddangosirDewis pa fathau o ffeiliau a ddangosirData cyfresol wedi ei gam-ffurfioData cyfresol wedi'i gam-ffurfio. Nid GTKTEXTBUFFERCONTENTS-0001 yw'r rhan gyntafByrlwybr %s yn bodoli'n barodNid yw'r byrlwybr %s yn bodoliDangos Opsiynau GTK+Dangos Ffeiliau _CuddDangos Adnoddau _Preifat_Maint:SymlMaintMaint y paled mewn modd 8-didCwblhad unigolMae rhai o'r gosodiadau o fewn y ddeialog yn gwrthdaroRhowch un neu fwy o rediadau tudalen, e.e. 1-3,7,11Gorlifodd y stacArferolDechrau %sStatws_Ffit OrauCy_sylltu_TorriLleihau MewnoliadGwallChwilio ac _AilosodCynyddu MewnoliadGwybodaethTirlunPortread_Rhagolwg ArgraffuCwestiwnCadw _FelDewis _PopethRhybudd_ChwyddoC_rebachu_Ynghylch_Ychwanegu_Gosod_Cynyddol_Bras_CD-Rom_Diddymu_Canoli_Clirio_Cau_Lliw_Trosi_Copïo_Dileu_Disgynnol_Hepgor_Datgysylltu_GolyguGw_eithredu_Llenwi_Disg Hyblyg_Ffont_Sgrin Lawn_Disg Galed_Cymorth_CartrefMynega_i_Gwybodaeth_Italig_Neidio iGadael Modd Sgrin _Lawn_ChwithRh_wydwaith_Newydd_NaMai_nt Arferol_Iawn_Agor_Gludo_Hoffterau_Argraffu_Priodweddau_Gadael_Ail-wneud_Diweddaru_Tynnu_Adfer_Dde_CadwCywiro _SillafuAro_s_Taro drwodd_Datddileu_Tanlinellu_Dadwneud_IeS_eibio_BlaenorolAil_ddirwyn_Ymlaen_Nesaf_Chwarae_Recordio_Aros_Yn Ôl_GwaelodI _LawrCynta_f_Ymlaen_Diwethaf_TopI _FynyMae gan y ddelwedd TGA ddimensiynau annilysNi chynhelir math y ddelwedd TGAMethodd y weithred TIFFClose_Dwyochrog:Tag "%s" eisoes wedi ei ddiffinioTag "%s" ddim yn bodoli yn y byffer, felly'n methu creu tagiau.Mae gan y tag "%s" y flaenoriaeth "%s", sy'n annilysNid yw'r tag "%s" wedi ei ddiffinio.Thai-LaoY fformat delwedd ANIY fformat delwedd BMPY fformat delwedd EMFY fformat delwedd GIFY fformat delwedd ICNSY fformat delwedd ICOY fformat delwedd JPEG 2000Y fformat delwedd JPEGY fformat delwedd PCXY fformat delwedd PNGY teulu fformatau delwedd PNM/PBM/PGM/PPMFformat delwedd raster SunY fformat delwedd TIFFY fformat delwedd TargaY fformat delwedd WBMPY fformat delwedd WMFY fformat delwedd XBMY fformat delwedd XPMCanfuwyd y briodwedd "%s" ddwywaith ar yr elfen <%s>Y lliw a ddewisoch.Y lliw rydych chi wedi ei ddewis. Fe allwch lusgo'r lliw yma at gofnod palet er mwyn ei gadw fel y gallwch ei ddefnyddio yn y dyfodol.Mae'r ffeil "%s" ar gyfrifiadur arall (o'r enw %s) ac mae'n bosib nad yw ar gael i'r rhaglen hwn. Ydych chi'n siwr eich bod chi eisiau ei ddewis?Mae'r ffeil eisoes yn bodoli yn "%s". Bydd amnewid y ffeil yn trosysgrifo'i chynnwys.Mae'r enw ffeil "%s" yn cynnwys symbolau ni chaniateir mewn enwau ffeiliauNi ellwyd trosi'r enw ffeil "%s" i UTF-8 (ceisiwch osod y newidyn amgylchol G_FILENAME_ENCODING): %sNi fedrwyd dangos cynnwys y blygellMethu creu'r blygellMethu creu'r blygell, am fod ffeil â'r un enw yn bodoli eisoes. Ceisiwch roi enw gwahanol i'r blygell, neu ail-enwi'r ffeil yn gyntaf.Mae'r enw plygell "%s" yn cynnwys symbolau ni chaniateir mewn enwau ffeiliauRoedd y storfa a grëwyd yn annilys. Trwydded y rhaglenY lliw ddewiswyd o'r blaen, er mwyn cymharu gyda'r lliw rydych chi'n ei ddewis nawr. Fe allwch lusgo'r lliw yma at gofnod palet, neu dewis y lliw yma gan ei lusgo at y sampl arall ar ei bwys.Methodd y rhaglen a chreu cysylltiad â'r ellyll mynegai. Gwnewch yn siŵr ei fod yn rhedeg.Nid yw'r gosodiad yma o gdk-pixbuf yn cynnal cadw'r fformat delwedd: %sNid yw'r swyddogaeth hon ar gael i declynnau o'r dosbarth '%s'Tigrigna-Eritrean (EZ+)Tigrigna-Ethiopian (EZ+)Amser yr argraffiadCyfrinachol IawnNi ellir cywasgu delweddau BMP top-i'r-gwaelodMae gan y ddelwedd JPEG drawsffurfedig hyd neu led o sero.Mae gan y ddelwedd JPEG2000 drawsffurfedig hyd neu led o sero.Mae gan y ddelwedd PNG drawsffurfedig nifer o sianeli na chynhelir, rhaid bod 3 neu 4 sianel.Mae gan y ddelwedd PNG drawsffurfedig hyd neu led sero.Nid yw'r ddelwedd PNG yn y ffurf RGB neu RGBA.Cyfieithwyd ganTryloywder y lliw.Diffodd allbwn amleiriogDwy OchrTeipiwch enw ffeilTeipiwch enw'r plygell newyddMethu diweddu prosesMethu canfod eitem gyda'r URI '%s'Methu canfod ffeil cynnwys: "%s"Methu llwytho modiwl llwytho delweddau: %s: %sMethu canfod ffeil delwedd yn pixmap_path: "%s"Methu canfod peiriant thema yn module_path: "%s",Di-ddosbarthDid-ddyfnder annisgwyl ar gyfer cofnodion map lliwiauData nod annisgwyl ar linell %d nod %dDiwedd annisgwyl i ddata delwedd PNMDarn eicon annisgwyl mewn animeiddiadTag cychwyn '%s' annisgwyl ar linell %d nod %dAnhysbysGwall anhysbys wrth geisio dad-gyfresu %sEitem anhysbysFformat delwedd anhysbysGwall anhysbysGofod lliw JPEG ni chynhelir (%s)Math animeiddiad ni chynhelirDyfnder ni chynhelir ar gyfer ffeil ICO: %dMath eicon ni chynhelirI Fyny'r LlwybrPwysigGwirio'r storfa eiconau sy'n bodoliNi allwyd trawsffurfio gwerth testun delwedd PNG %s i amgodiad ISO-8859-1.Ni chynhelir fersiwn %s y fformat delwedd GIFFietnameg (VIQR)Lefel SainLefel Sain i LawrLefel Sain i FynyMae hyd neu led y ddelwedd TIFF yn seroFfenestrYsgrifennwyd ganModd Mewnbwn X_Osgo X:Y dangosydd X i'w ddefnyddioY sgrîn X i'w ddefnyddioMae gan y ffeil delwedd XPM hyd <= 0Mae gan y ffeil delwedd XPM lled <= 0Mae gan y ffeil delwedd XPM nifer annilys o liwiauMae gan y ddelwedd XPM nifer annilys o feitiau i bob picselO_sgo Y:Ddoe am %H:%MFe allwch benodi gwerth lliw hecsadegol, yn yr un modd a defnyddir yn HTML, new enw lliw megis 'oren' yma.Cragen ZZWJ Ym_unydd lled seroZWNJ _Nid-ymunydd lled seroZWS Bwlch lled _sero_Ychwanegu_Ychwanegu at y Llyfrnodau_Ar ôl:Pob Tud_alen_Gwybodaeth bilio:G_las:_Gwaelod:_Pori am blygellau eraill_Clirio'r Rhestr_Dyfais:_Diweddu Proses_Teulu:_Ffeiliau_Enw'r plygell:_Ffurf ar gyfer:_Gwerth GammaG_wyrdd:_Uchder:_Arlliw:_Mewnosod Nod Rheoli Unicode_Chwith:_Trwydded_Lleoliad:_Modd:_Enw:_Plygell Newydd_Nawr_Printio'r rhain yn unig:_Agor y Cyswllt_Gogwydd:_Ffurf yr allbwn_Palet:Maint _papur:_Cyfrinair:_Llefydd_Pwysedd:_Rhagolwg:_Coch:_Tynnu_Tynnu o'r Rhestr_Ailenwi_Ailenwi Ffeil_Amnewid_Gwrthdroi_De:_Dirlawnder:_Cadw'r lliw fan hyn_Cadw mewn plygell:_Dewis: _Arddull:_Top:_Gwerth:_Olwyn:_Lled:_X:_Y:abcchdddefffgnghi%Ycalendar:MY%d%dcalendar:week_start:1default:LTRdefault:mmidatas gwahanol wedi'u canfod ar gyfer '%s' a '%s' sydd â chyswllt symbolaidd rhyngddynt methu creu byffer delwedd %u beitmethu creu byffer delwedd %u feitmodfeddSystemSystem (%s)AltÔlnodSlaes ôlCychwynCtrlLawrDiweddCartrefHyperMewnosodChwithMetaTudalen_i_LawrTudalen_i_FynySeibioArgraffuDychwelydDdeSgrol_GloShiftGofodSuperSys_ReqTabFynymmdimallbwn.%sAmlen #10Amlen #11Amlen #12Amlen #14Amlen #910x1110x1310x1410x1511x1211x1512x195x7Amlen 6x9Amlen 7x9Amlen 9x11A0A0x2A0x3A1A10A1x3A1x4A2A2x3A2x4A2x5A3A3 EstynedigA3x3A3x4A3x5A3x6A3x7A4A4 EstynedigTab A4A4x3A4x4A4x5A4x6A4x7A4x8A4x9A5A5 EstynedigA6A7A8A9Arch AArch BArch CArch DArch EB0B1B10B2B3B4B5B5 EstynedigB6B6/C4B7B8B9C0C1C10C2C3C4C5C6C6/C5C7C7/C6C8C9Amlen Choukei 2Amlen Choukei 3Amlen Choukei 4Amlen DLDai-pa-kaiedp EwropeaiddGweithredol (Executive)Ffanblyg EwropeaiddFfanblyg Cyfreithiol AlmaenaiddFfanblyg UDAFolioFolio spCyfreithiol LlywodraetholLlythyr LlywodraetholMynegai 3x5Mynegai 4x6 (cerdyn post)Mynegai 4x6 estMynegai 5x8Amlen WahoddiadAnfonebAmlen EidalaiddJB0JB1JB10JB2JB3JB4JB5JB6JB7JB8JB9Amlen MonarchAmlen BersonolAmlen PostfixQuartoRA0RA1RA2ROC 16kROC 8kSRA0SRA1SRA2Ffoto BachSuper ASuper BTabloidCyfreithiol UDACyfreithiol Estynedig UDALlythyr UDALlythyr Estynedig UDALlythyr Plus UDAFfurf LydanAmlen a2asme_fb-pluscAmlen c5deedpfhagaki (cerdyn post)jis execjuuro-ku-kaiAmlen kahuAmlen kaku2oufuku (cerdyn post ymateb)pa-kaiprc 16kprc 32kAmlen prc1Amlen prc10Amlen prc2Amlen prc3Amlen prc4Amlen prc5Amlen prc6Amlen prc7Amlen prc8Amlen you4Wedi gorffenWedi gorffen, gyda gwallArgraffuAros%d %%_%d. %sprawf-allbwn.%samrywiad delwedd RAS ni chynhelir%d %%2000LC_MESSAGES/rhn-client-tools.mo000064400000011265152343356400012101 0ustar00&L5|P Q\qma$x+ 2 )<%f!!' 4()].(: 1:R"&%*XP:E.* ,Y )  u 3 ! " ' -- [ 3{ / * ' 2$J)o\82kO9'A6%x% `-FE*(FEo&  ! " #$ % Aborted. %s was not foundA common cause of this error is the system time being incorrect. Verify that the time on this system is correct. A profilename was not specified, and hostname and IP address could not be determined to use as a profilename, please specify one.An error has occurred:An unexpected OS error occurred: %s Connection aborted by the userDelay error from server. The message was: ERROR: can not find RHNS CA fileError communicating with server. The message was: Error parsing the oemInfo file at field: Error reading networking information:Error validating data at server: File Not Found: Password error. The message was: RPM dependency error. The message was: RPM error. The message was: Register the system even if it is already registeredSee /var/log/up2date for more informationServer has refused connection due to high loadShow additional outputSpecify a file to use as the ssl CA certSpecify a password to use with an authenticated http proxySpecify a url to use as a serverSpecify a username to use with an authenticated http proxySpecify an activation keySpecify an http proxy to useThe installation number is invalidThere was an SSL error: %s There was an authentication error: %s There was some sort of I/O error: %s This client requires the server to support %s, which the current server does not supportThis system is already registered. Use --force to overrideThis system may not be updated until it is associated with a channel.Warning: unable to enable rhnsd with chkconfigWarning: unable to enable rhnsd with systemd[Deprecated] Read contact info from stdinProject-Id-Version: Spacewalk Report-Msgid-Bugs-To: POT-Creation-Date: 2025-07-08 16:16+0300 PO-Revision-Date: 2018-03-16 10:59+0000 Last-Translator: Copied by Zanata Language-Team: Welsh (http://www.transifex.com/projects/p/spacewalk/language/cy/) Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; X-Generator: Zanata 4.6.2 Erthylwyd. Ni chafwyd %sMae bod yr amser system yn anghywir yn achos cyffredin o'r gwall yma. Gwiriwch fod yr amser ar y system yma'n gywir. Ni phenodwyd enw proffil, ac nid oedd modd pennu enw gwesteiwr a chyfeiriad IP i'w defnyddio fel enw proffil, penodwch un os gwelwch yn dda.Digwyddodd gwall OS annisgwyl: %sDigwyddodd gwall OS annisgwyl: %s Erthylwyd y cysylltiad gan y defnyddiwrGwall oedi o'r gweinydd. Dyma oedd y neges: GWALL: Ni chafwyd ffeil RHNS CAGwall cyfathrebu â'r gweinydd. Dyma oedd y neges: Gwall wrth ddyrannu'r ffeil oemInfo wrth faes: Gwall wrth ddarllen gwybodaeth rhwydwaith:Gwall wrth wirio data wrth y gweinydd: Ffeil Heb ei Chanfod: Gwall cyfrinair. Dyma oedd y neges: Gwall dibyniaeth RPM. Dyma oedd y neges: Gwall RPM. Dyma oedd y neges: --force - cofrestru'r system hyd yn oed os yw'n gofrestredig yn barodAnfon gwybodaeth _caledweddGwrthodwyd cysylltiad â'r gweinydd o achos llwyth uchelDangos allbwn ychwanegol --sslCACert= - penodwch ffeil i'w defnyddio fel y tyst ssl CAPenodwch gyfrinair i'w ddefnyddio â dirprwy http dilysolPenodwch ba url gweinydd i'w ddefnyddioPenodwch enw defnyddiwr i'w ddefnyddio â dirprwy http dilysiedigPenodwch ddirprwy http i'w ddefnyddioPenodwch ddirprwy http i'w ddefnyddioAnnilys yw'r rhif tanysgrifiadBu gwall SSL: %s Bu gwall dilysiant: %s Roedd rhyw fath o wall M/A: %s Mae'r dibynnydd yma'n mynnu bod y gweinydd yn cynnal %s, nad yw'r gweinydd cyfredol yn ei gynnalMae'r system yma'n gofrestredig yn barod. Defnyddiwch --force i orfodiNi cheir diweddaru'r system yma nes ei bod yn gysylltiedig â sianel.Rhybudd: methu galluogi rhnsd â chkconfigRhybudd: methu galluogi rhnsd â systemd --contactinfo - darllen gwybodaeth gysylltu o stdin LC_MESSAGES/iso_639-2.mo000064400000010726152343356400010233 0ustar00pp q {                $ * 1 9 C L T [ c j s |                # + / 5 = E P [ d j t |                    ' 1 9 ? G O U [ a h m u |             V^ fqy     !+3<EMV^fow      !(0 8 BLU ]ipx~ !*28?GOW_fjrz  E i"6Kbc29[+R8DY^ Ak*'I,:/m40;.ej?d(1XOgG`]T l-Mp=WH PUQFJ<VL&3fC7Z@_B#Na)!So> $\n %h5AbkhazianAfarAfrikaansAlbanianAmharicArabicArmenianAssameseAymaraAzerbaijaniBasqueBelarusianBengaliBislamaBretonBulgarianBurmeseChineseCornishCorsicanCroatianCzechDanishEnglishEsperantoEstonianFaroeseFijianFinnishFrenchGalicianGeorgianGermanGuaraniGujaratiHausaHebrewHindiHungarianIcelandicIndonesianInuktitutInupiaqIrishItalianJapaneseJavaneseKannadaKashmiriKazakhKinyarwandaKoreanKurdishLaoLatinLatvianLingalaLithuanianMacedonianMalagasyMalayMalayalamMalteseManxMaoriMarathiMongolianNauruNepaliNorwegianOriyaOromoPolishPortugueseQuechuaRundiRussianSamoanSangoSanskritSerbianShonaSindhiSlovakSlovenianSomaliSundaneseSwahiliSwatiSwedishTagalogTajikTamilTatarTeluguThaiTibetanTsongaTswanaTurkishTurkmenTwiUrduUzbekVietnameseWelshWolofXhosaYiddishYorubaZuluProject-Id-Version: iso_639-2 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2002-08-14 20:57+0100 Last-Translator: Dafydd Tomos Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit AbcasegAffaregAffricanegAlbanegAmharegArabegArmenegAsamegAimaregAserbaijaniBasgegBelarwsegBengalegBislamaLlydawegBwlgaregByrmanegTsieinëegCernywegCorsegCroategTsiecegDanegSaesnegEsperantoEstonegFfaröegFfijïegFfinnegFfrangegGalisegGeorgegAlmaenegGwaraniGwjwratiHawsaHebraegHindiHwngaregIslandegIndonesegInwctitwtInwpiacGwyddelegEidalegSiapanegJafanegCanaregCashmiregCazachegCiniarwandaCorëegCwrdegLaoegLladinLatfiegLingalaLithwanegMacedonegMalagasiMalaiegMalaialamegMaltegManawegMaoriMaratiMongolegNawrŵegNepalegNorwyegOrïaOromoPwylegPortiwgalegCetshwaRwndiRwsiegSamöegSangoSansgritSerbegShonaSindhiSlofacegSlofenegSomaliegSwndanegSwahiliSwatiSwedegTagalogTajicegTamilegTataregTelwgwTaiTibetegTsongegTswanaTyrcegTyrcmenegTwiWrdwWsbecegFietnamegCymraegWoloffXhosaIddewegIorwbaZwlwLC_MESSAGES/newt.mo000064400000001155152343356400007652 0ustar00DlZbejCancelNoOkYesProject-Id-Version: newt Report-Msgid-Bugs-To: POT-Creation-Date: 2016-03-23 15:59+0100 PO-Revision-Date: 2004-11-20 04:23-0500 Last-Translator: Dafydd Harries Language-Team: Welsh MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Language: cy Plural-Forms: nplurals=4; plural= (n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3 X-Generator: Zanata 3.8.2 DiddymuNaIawnIeLC_MESSAGES/usermode.mo000064400000021670152343356400010524 0ustar00Tq\ !\; # *4 :E+JUv ) 7 B W b u      : 1 > R U j r   2 E P m z    $ A % %C i 4 _  J j y   >zz<?G} -<.U*5&(#=aKWe%5O Vb hs"zO" 01 bo   3Pe} AMk "&A7!y!3e pBy y#yuu}}yyy $ !!6"?"F"\"k")" "%"3"&#$B#)g#&#&-J>.=" 6,+EI:L8H37% 'D5N OAQS)#;?@4M$(FGRC2*TP/  B9K0!1 <(current) UNIX password: Are you sure you want to format this disk? You will destroy any data it currently contains.BAD PASSWORD: it is too shortBAD PASSWORD: it's WAY too shortCancelCannot fork(). Changing login shell.Changing personal information.DeviceDirectoryErrorError: %s ExitFailed to drop administrator privileges: %sFailed to drop administrator privileges: pam_timestamp_check returned failure code %dFailed to find selected program.Failed to run command "%s": %s Failed to set IO channel nonblocking: %s FilesystemForget AuthorizationFull Name:Home Phone Number:InformationInformation updated.Insufficient rights.Internal PAM error occured.Invalid call to subprocess.Keep AuthorizationLaunch system-wide configuration tools without a password.Login Shell:New UNIX password: OKOffice Phone Number:Office:One or more of the changed fields is invalid. This is probably due to either colons or commas in one of the fields. Please remove those and try again.Out of memory.Password resetting error.Password unchangedPassword: Perform a _low-level format.Pipe error. QueryRequest canceled.Retype new UNIX password: Run UnprivilegedSelect a _filesystem type to create:Some systems files are locked. Please try again in a few moments.Sorry, passwords do not matchThe device '%s' can not be formatted.The exec() call failed.The password you typed is invalid. Please try again.There are no filesystems which you are allowed to mount or unmount. Contact your administrator.Un_mountUnable to open graphical window, and unable to find controlling terminal. Unknown error.Unknown exit code.Unknown user.User InformationUser Mount ToolYou are attempting to run "%s" which may benefit from administrative privileges, but more information is needed in order to do so.You are attempting to run "%s" which may benefit from administrative privileges, but more information is needed in order to do so.You are attempting to run "%s" which requires administrative privileges, but more information is needed in order to do so.You are attempting to run "%s" which requires administrative privileges, but more information is needed in order to do so.You are attempting to run a command which may benefit from administrative privileges, but more information is needed in order to do so.You are attempting to run a command which may benefit from administrative privileges, but more information is needed in order to do so.You are attempting to run a command which requires administrative privileges, but more information is needed in order to do so.You are attempting to run a command which requires administrative privileges, but more information is needed in order to do so.You don't exist. Go away. You're currently authorized to configure system-wide settings (that affect all users) without typing the administrator password again. You can give up this authorization.Your current shell is not listed in /etc/shells. You are not allowed to change your shell. Consult your system administrator._Format_Mount_Run Unprivilegeddup2() error. execl() error, errno=%d invalid controlling tty in pam_timestamp_checklogin: no controlling tty for pam_timestamp_checkpam-panel-icon: failed to connect to session manager pam_timestamp_check is not setuid rootpermissions error in pam_timestamp_checkuser unknown to pam_timestamp_checkuserhelper must be setuid root Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2012-08-21 00:32+0200 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit PO-Revision-Date: 2015-03-21 02:49-0400 Last-Translator: Copied by Zanata Language-Team: LANGUAGE Language: cy Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; X-Generator: Zanata 3.9.6 Cyfrinair UNIX (cyfredol)Ydych chi'n siwr eich bod am fformadu'r ddisg? Byddwch yn dinistrio unrhyw ddata arni.CYFRINAIR GWAEL: mae'n rhy fyrCYFRINAIR GWAEL: mae'n LLAWER rhy fyrDileuMethu fforchio(). Newid plisgyn mewngofnodiNewid gwybodaeth bersonolDyfaisCyfeiriadurGwallGwall: %s GadaelMethu colli hawliau gweinyddwr: %sMethu colli hawliau gweinyddwr: dychwelodd pam_timestamp_check côd methiant %dMethu canfod y raglen ddewisiedig.Methu rhedeg gorchymyn "%s": %s Wedi methu gwneud sianel IO yn ddi-rwystrus: %s System ffeilAnghofio awdurdodEnw Llawn:Rhif Ffôn Cartref:GwybodaethDiweddarwyd y wybodaethHawliau annigonolDigwyddodd gwall mewnol PAM.Galwad annilys i is-broses.Cadw awdurdodCychwyn erfynnau cyflunio system-eang heb gyfrinairPlisgyn Mewngofnodi:Cyfrinair UNIX (newydd)IawnRhif Ffôn y Swyddfa:Swyddfa:Mae un neu fwy o'r meysydd sydd wedi newid yn annilys. Mae hyn oherwydd naill ai gorwahannodau neu atalnodau yn un o'r meysydd. Tynnwch rheini a cheisiwch eto.Allan o gofGwall wrth ailosod cyfrinair.Cyfrinair heb ei newidCyfrinair: Cyflawni fformadiad lefel_isel.Gwall pibell. YmholiadDiddymwyd y cais.Aildeipiwch cyfrinair UNIX newydd:Rhedeg Heb FreintiauDewiswch math system _ffeil i'w chreu:Mae rhai ffeiliau system wedi eu cloi. Ceisiwch eto mewn ychydig.Nid yw'r cyfrineiriau'n cydweddu.Ni ellir fformatio y dyfais '%s'.Methodd yr alwad exec().Mae'r gyfrinair a deipioch yn annilys Ceisiwch eto.Nid oes systemau ffeil y mae gennych hawl i'w gosod neu eu dadosod. Gofynnwch i'ch gweinyddwr system.Dad_osodMethu agor ffenestr raffigol, ac yn methu canfod terfynell reoli. Gwall anhysbysCôd gadael anhysbysDefnyddiwr anhysbysGwybodaeth DefnyddiwrErfyn Gosod y DefnyddiwrRydych yn ceisio rhedeg "%s" a allai elwa o freintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg "%s" a allai elwa o freintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg "%s" sy'n mynnu breintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg "%s" sy'n mynnu breintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg gorchymyn a allai elwa o freintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg gorchymyn a allai elwa o freintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg gorchymyn sy'n mynnu breintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Rydych yn ceisio rhedeg gorchymyn sy'n mynnu breintiau gweinyddol, ond mae angen rhagor o wybodaeth er mwyn gwneud hynny.Nid ydych yn bodoli. Ewch i ffwrdd. Mae'r hawl gennych i fyrfweddu gosodiadau system-eang (sy'n effeithio pob defnyddiwr) heb teipio'r cyfrinair gwraidd eto. Gallwch ildio'r hawl yma. Nid yw eich plisgyn cyfredol wedi ei restri yn /etc/shells. Nid oes hawl gennych i newid eich plisgyn. Gofynnwch i'ch gweinyddwr system._Fformat_Gosod_Rhedeg Heb Freintiaugwall dup2(). gwall execl() , rhif gwall=%d tty rheoli annilys yn pam_timestamp_checkmewngofnod: dim tty rheoli am pam_timestamp_checkpam-panel-icon: methu cysylltu i'r rheolydd sesiwn Nid setuid root yw pam_timestamp_checkgwall hawliau yn pam_timestamp_checkdefnyddiwr anhysbys i pam_timestamp_checkRhaid i userhelper fod yn setuid root LC_MESSAGES/initscripts.mo000064400000032220152343356400011245 0ustar00kt ! ( '1 Y *\ %  M   # 1 R s  b  -( V q 3   + F Cg 5 ` B %a ? ? 3;B5`*=@@`="6`5/DnBYW Wc"(/$7(\((#"/.N%}A?+%,Q,~*9;S"p/,) ?(9h4019:t<'$!9L[^GZW>74)F^6/& 131e3, 4(0+)\K # +5 $a  s !!54!j!!>!!!,"NE"L"9"o#$#)#M#J($1s$$$D$; %QG%=%%ke&>&2'7C'2{'E'u'Zj(g([-)%)))0)# *&.*$U**z*$*!*2*/+#O+9s+L+3+0.,,_, ,-,@,P-W-%u-+-+---!.H0.9y.4.2.3/;O//>/ /)0&00'W0R00p0NK1U1=1:.22i2M2C24.3,c3;3=3 49'4.a4XTMi) $*"e3] -5h9B:cdDSO#8ZK6PF_ ^f,NbIEYL=H[Q%k&.'A4V<G;2R ?W0>(g/j7!`aC 1\@JU+ done. failed. failed; no link present. Check cable?$*$0: Usage: daemon [+/-nicelevel] {program}$0: configuration for ${1} not found.$STRING$alias device ${DEVICE} does not seem to be present, delaying initialization.$base $killlevel$base shutdown$base startup${base} (pid $pid) is running...${base} dead but pid file exists${base} dead but subsys locked${base} is stopped'No route to host' adding route '$networkipv6' via gateway '$gatewayipv6' through device '$device'6to4 configuration is not validBridge support not available: brctl not foundBringing up interface $i: Bringing up loopback interface: Cannot add IPv6 address '$address' on dev '$device'Configured devices:Currently active devices:Determining IP information for ${DEVICE}...Device ${DEVICE} does not seem to be present, delaying initialization.Device ${DEVICE} has different MAC address than expected, ignoring.Device '$DEVICE' is already up, please shutdown firstDevice '$DEVICE' isn't supported here, use IPV6_AUTOTUNNEL setting and restart (IPv6) networkingDevice '$device' doesn't existDevice '$device' enabling didn't workDevice 'tun6to4' (from '$DEVICE') is already up, shutdown firstERROR: could not add vlan ${VID} as ${DEVICE} on dev ${PHYSDEV}Error occurred while calculating the IPv6to4 prefixFAILEDFailed to bring up ${DEVICE}.Given IPv4 address '$ipv4addr' is not globally usableGiven IPv6 MTU '$ipv6_mtu' is out of rangeGiven IPv6 default device '$device' doesn't exist or isn't upGiven IPv6 default device '$device' requires an explicit nexthopGiven IPv6 default gateway '$address' has scope '$device_scope' defined, given default gateway device '$device' will be not usedGiven IPv6 default gateway '$address' is link-local, but no scope or gateway device is specifiedGiven IPv6 default gateway '$address' is not in proper formatGiven address '$addr' is not a global IPv4 one (arg 1)Given address '$addr' is not a valid IPv4 one (arg 1)Given device '$device' is not supported (arg 1)Given pidfile '$pidfile' doesn't exist, cannot send trigger to radvdGiven remote address '$addressipv4tunnel' on tunnel device '$device' is already configured on device '$devnew'Global IPv6 forwarding is disabled in configuration, but not currently disabled in kernelGlobal IPv6 forwarding is enabled in configuration, but not currently enabled in kernelIPv6to4 configuration needs an IPv4 address on related interface or otherwise specifiedMissing config file $PARENTCONFIG.Missing parameter 'IPv4 address' (arg 1)Missing parameter 'IPv4-tunnel address' (arg 2)Missing parameter 'IPv6 MTU' (arg 2)Missing parameter 'IPv6-address' (arg 2)Missing parameter 'IPv6-gateway' (arg 2)Missing parameter 'IPv6-network' (arg 1)Missing parameter 'address' (arg 1)Missing parameter 'device' (arg 1)Missing parameter 'global IPv4 address' (arg 2)Missing parameter 'local IPv4 address' (arg 2)Missing parameter 'selection' (arg 2)Missing remote IPv4 address of tunnel, configuration is not validNo 802.1Q VLAN support available in kernel for device ${DEVICE}No 802.1Q VLAN support available in kernel.No parameters given to setup a default routeNo reason given for sending trigger to radvdPASSEDPHYSDEV should be set for device ${DEVICE}Pidfile '$pidfile' is empty, cannot send trigger to radvdPlease restart network with '/sbin/service network restart'Shutting down interface $i: Shutting down loopback interface: Tunnel device '$device' bringing up didn't workTunnel device '$device' creation didn't workTunnel device 'sit0' enabling didn't workUnknown errorUnsupported mechanism '$mechanism' for sending trigger to radvdUnsupported reason '$reason' for sending trigger to radvdUnsupported selection '$selection' specified (arg 2)Usage: $0 {start|stop|reload|restart|showsysctl}Usage: $0 {start|stop|status|restart|condrestart}Usage: $0 {start|stop|status|restart|reload|force-reload}Usage: ifup Usage: killproc [-p pidfile] [ -d delay] {program} [-signal]Usage: pidfileofproc {program}Usage: pidofproc [-p pidfile] {program}Usage: status [-p pidfile] {program}Users cannot control this device.Using 6to4 and RADVD IPv6 forwarding usually should be enabled, but it isn'tWARNINGWarning: configured MTU '$IPV6TO4_MTU' for 6to4 exceeds maximum limit of '$tunnelmtu', ignoredWarning: interface 'tun6to4' does not support 'IPV6_DEFAULTGW', ignoredWarning: ipppd (kernel 2.4.x and below) doesn't support IPv6 using encapsulation 'syncppp'Warning: link doesn't support IPv6 using encapsulation 'rawip'error in $FILE: IPADDR_START and IPADDR_END don't agreeerror in $FILE: IPADDR_START greater than IPADDR_ENDerror in $FILE: already seen device $parent_device:$DEVNUM in $devseenerror in $FILE: already seen ipaddr $IPADDR in $ipseenerror in $FILE: didn't specify device or ipaddrerror in ifcfg-${parent_device}: filesradvd control enabled, but config is not completeradvd not (properly) installed, triggering failedusage: ifdown usage: ifup-aliases [] usage: ifup-routes []Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: YEAR-MO-DA HO:MI+ZONE MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit PO-Revision-Date: 2015-03-13 03:00-0400 Last-Translator: Copied by Zanata Language-Team: Language: cy Plural-Forms: nplurals=4; plural=(n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3; X-Generator: Zanata 3.9.6 wedi'i wneud. wedi methu. wedi methu; dim cyswllt yn bresennol. Gwirio cebl?$*$0: Defnydd: daemon [+/-lefel dymunol] {rhaglen}$0: ni chanfuwyd cyfluniad ar gyfer ${1}.$STRINGNid yw $alias device ${DEVICE} i weld yn bresennol, sy'n gohirio ymgychwyn.$base $killlevel$base wedi cau i lawrymgychwyn $basemae ${base} (pid $pid) yn rhedeg...${base} yn farw ond mae ffeil pid yn bodoli${base} yn farw ond is-system ar glomae ${base} wedi'i atal'Dim llwybr at westeiwr' yn ychwanegu llwybr '$networkipv6' drwy'r porthydd '$gatewayipv6' drwy'r ddyfais '$device'nid yw'r cyfluniad 6to4 yn ddilysNid yw cynhaliaeth pontio ar gael: ni chanfuwyd brctlYn codi rhyngwyneb $i: Yn codi rhyngwyneb ôl-gylchu: Methu ychwanegu cyfeiriad IPv6 '$address' ar ddyfais '$device'Dyfeisiau cyfluniedig:Dyfeisiau gweithredol cyfredol:Yn pennu gwybodaeth IP ar gyfer ${DEVICE}...Nid yw $alias device ${DEVICE} i weld yn bresennol, felly'n gohirio ymgychwyn.Mae gan y ddyfais ${DEVICE} gyferiad MAC gwahanol i'r disgwyl, yn anwybyddu.Mae dyfais '$DEVICE' i fyny'n barod, caewch i lawr gyntafNi chynhelir y ddyfais '$DEVICE' yma, defnyddiwch y gosodiad IPV6_AUTOTUNNEL ac ail-gychwyn rhwydweithio (IPv6)Nid yw'r ddyfais '$device' yn bodoliNi weithiodd galluogi'r ddyfais '$device'Mae'r ddyfais 'tun6to4' (o '$DEVICE') i fyny'n barod, caewch i lawr yn gyntafGWALL: methwyd ychwanegu vlan ${VID} fel ${DEVICE} ar y ddyfais ${PHYSDEV}Digwyddodd gwall wrth gyfri'r rhagddodiad IPv6to4METHIANTMethwyd codi ${DEVICE}.Methu defnyddio'r cyfeiriad IPv4 a roddwyd, sef '$ipv4addr', yn eangMae'r MTU IPv6 '$ipv6_mtu' a roddwyd y tu hwnt i'r amrediadNid yw'r ddyfais IPv6 ragosodedig '$device' a roddwyd yn bodoli neu nid yw i fynyMynna'r ddyfais IPv6 ragosodedig '$device' naid nesaf benodolMae gan y porth IPv6 rhagosodedig '$address' faes '$device_scope' wedi'i ddiffinio, felly ni ddefnyddir y ddyfais porth ragosodedig '$device'Mae'r porthydd IPv6 rhagosodedig '$address' yn gyswllt-leol, ond nid oes maes na dyfais porth wedi'u penodiNid yw'r porth IPv6 rhagosodedig '$address' yn y fformat cywirNid yw'r cyfeiriad '$addr' yn un eang IPv4 (ymr 1)Nid yw'r cyfeiriad IPv4 '$ipv4addr' yn ddilys (ymres 1)Ni chynhelir y ddyfais '$device' a roddwyd (ymr 1)Nid yw'r ffeil pid '$pidfile' yn bodoli, methu anfon sbardun at radvdMae'r cyfeiriad pell '$addressipv4tunnel' ar y ddyfais dwnel '$device' wedi'i chyflunio ar y ddyfais '$devnew' eisoesMae gyrru IPv6 ymlaen eang yn analluog mewn cyfluniad, ond ddim yn analluog yn y cnewyllynMae gyrru IPv6 ymlaen eang wedi'i alluogi mewn cyfluniad, ond ddim yn alluog yn y cnewyllyn yn gyfredolMae angen cyfeiriad IPv4 ar ryngwyneb perthynol neu'n benodedig ryw ffordd arall ar IPv6to4Ffeil gyflunio ar goll $PARENTCONFIG.Paramedr 'cyfeiriad IPv4' ar goll (ymr 1)Paramedr 'cyfeiriad twnnel IPv4' ar goll (ymr 2)Paramedr 'MTU IPv6' ar goll (ymr 2)Paramedr 'cyfeiriad IPv6' coll (ymr 2)Paramedr coll 'IPv6-gateway' (ymr 2)Paramedr 'rhwydwaith IPv6' ar goll (ymr 1)Paramedr 'cyfeiriad' ar goll (ymr 1)Paramedr 'dyfais' ar goll (ymr 1)Paramedr 'cyfeiriad IPv4 byd-eang' ar goll (ymr 2)Paramedr 'cyfeiriad IPv4 lleol' ar goll (ymr 2)Paramedr 'dewisiad' ar goll (ymr 2)Cyfeiriad IPv4 pell ar goll, nid yw'r cyfluniad yn ddilysNim cynhaliaeth 802.1Q VLAN ar gael yn y cnewyllyn ar gyfer dyfais ${DEVICE}Dim cynhaliaeth VLAN 802.1Q ar gael yn y cnewyllyn.Ni roddwyd paramedrau i osod llwybr rhagosodedigNi roddwyd rheswm am anfon achosiad at radvdLLWYDDIANTRhaid gosod PHYSDEV ar gyfer dyfais ${DEVICE}Mae'r ffeil pid '$pidfile' yn wag, methu anfon achosiad at radvdAilddechreuwch y rhwydwaith â '/sbin/service network restart' os gwelwch yn ddaYn cau rhyngwyneb $i i lawr: Yn cau rhyngwyneb ôl-gylchu i lawr: Ni weithiodd codi'r ddyfais dwnel '$device'Ni weithiodd creu'r ddyfais dwnel '$device'Ni weithiodd galluogi'r ddyfais dwnnel 'sit0'Gwall anhysbysPeirianwaith '$mechanism' anghynnaledig ar gyfer anfon achosiad at radvdRheswm anghynnaledig '$reason' am anfon achosiad at radvdPenodwyd dewisiad '$selection' anghynnaledig (ymr 2)Defnydd: $0 {start|stop|reload|restart|showsysctl}Defnydd: $0 {start|stop|status|restart|condrestart}Defnydd: $0 {start|stop|status|restart|reload|force-reload}Defnydd: ifup Defnydd: killproc [-p pidfile] [ -d delay] {rhaglen} [-arwydd]Defnydd: pidfileofproc {rhaglen}Defnydd: pidofproc [-p pidfile] {rhaglen}Defnydd: status [-p pidfile] {program}Ni all ddefnyddwyr reoli'r ddyfais hon.Dylai defnyddio gyrru 6to4 a RADVD ymlaen IPv6 fod yn alluog fel arfer, ond nid ywRHYBUDDRhybudd: Mae'r MTU cyfluniedig '$IPV6TO4_MTU' ar gyfer 6to4 y tu hwnt i'r terfyn uchaf '$tunnelmtu', anwybyddwydRhybudd: nid yw'r rhyngwyneb 'tun6to4' yn cynnal 'IPV6_DEFAULTGW', anwybyddwydRhybudd: Nid yw ipppd (cnewyllyn 2.4.x ac is) yn cynnal IPv6 drwy'r amgaead 'syncppp'Rhybudd: nid yw'r cyswllt yn cynnal IPv6 drwy amgaead 'rawip'gwall yn $FILE: nid yw IPADDR_START a IPADDR_END yn cytunogwall yn $FILE: IPADDR_START yn uwch na IPADDR_ENDgwall yn $FILE: wedi gweld dyfais $parent_device:$DEVNUM yn $devseen yn barodgwall yn $FILE: wedi gweld cyfeiriad ip $IPADDR yn $ipseen yn barodgwall yn $FILE: ni phenododd dyfais na chyfeiriad ipgwall mewn ffeiliau ifcfg-${parent_device}: rheolydd radvd yn alluog, ond nid yw'r cyfluniad yn gyflawnnid yw radvd wedi'i arsefydlu (yn gywir), methodd yr achosiaddefnydd: ifdown defnydd: ifup-aliases [] defnydd: ifup-routes []LC_MESSAGES/gdk-pixbuf.mo000064400000044413152343356400010741 0ustar00 %)4-^! "(*-F,t,'* G"h*)+9#e&.,# 06K!"'2ZwN&?RYJ#9Sp"88W!o"&%BND0.&/ Cd%y-'"@ c"7$.$3*XO%/-)eW%rVgzJO2HH{$,3#G2k""## &, S r Q V !;! ]!&~!-!4!2"!;"]"}"A""" #(#E#`#u#######$%$':$b$~$$$$$$E%'F%*n%-%C%) & 5&+V&(& &"&&!'0'"K'n'G'2'%'%(D(%b()(V( ))),+3.+b+9u+*++#+#,(@,-i,;,-,--/-$K-%p---"-$- .$..?./n..1.$.)/5:/2p/!//)/ 0 0?0*_0"0+0,0$1*+1%V1|1M1#1 2N&2u2J2&233:3 V3w33:3:3%4'D4,l40404K4ZG58565?6R6l6$66(6/667U7q77'727 8)#88M838@8+81'9\Y9/9.9/:qE:#:r:N;i; ;;];T<Fr<T<=6,=:c= =&=B=))>+S>+>+>1>' ?'1?WY?W?$ @%.@2T@9@;@:@!8A,ZA$AFA'AB+,B XByBBBBBBCC7CNCdC)zCCCCCDD1DGGD.D:D>D]8E7E.E.E5,F$bF%FF!FF+G2GJJG-G'G$G%H26H;iHCH!H[!)Gy|'a~*rc5Aq7 xl(j1OvTfgo$e-tIQFm @ +"^Jk\,]=9 snU`ib<2M zDPpuwNdX3&YEB/%:.VRL SHK{?04>C6_Z8;W}h#BMP image has bogus header dataBMP image has unsupported header sizeBad code encounteredBits per channel of PNG image is invalid.Bits per channel of transformed PNG is not 8.Cannot allocate TGA header memoryCannot allocate colormap entriesCannot allocate colormap structureCannot allocate memory for IOBuffer dataCannot allocate memory for IOBuffer structCannot allocate memory for TGA context structCannot allocate memory for loading PNM imageCannot allocate memory for loading XPM imageCannot allocate new pixbufCannot allocate temporary IOBuffer dataCannot read XPM colormapCannot realloc IOBuffer dataCircular table entry in GIF fileCompressed icons are not supportedCould not allocate memory: %sCould not create stream: %sCould not get image height (bad TIFF file)Could not get image width (bad TIFF file)Could not read from stream: %sCouldn't allocate memory for context bufferCouldn't allocate memory for headerCouldn't allocate memory for line dataCouldn't allocate memory for loading JPEG fileCouldn't allocate memory for saving BMP fileCouldn't allocate memory for streamCouldn't create new pixbufCouldn't recognize the image file format for file '%s'Couldn't save the restCouldn't write to BMP fileCouldn't write to TIFF fileCursor hotspot outside imageDidn't get all lines of PCX imageDimensions of TIFF image too largeError interpreting JPEG image file (%s)Error reading ICNS image: %sError writing to image file: %sError writing to image streamExcess data in fileFailed to close '%s' while writing image, all data may not have been saved: %sFailed to load RGB data from TIFF fileFailed to load TIFF imageFailed to load animation '%s': reason not known, probably a corrupt animation fileFailed to load image '%s': %sFailed to load image '%s': reason not known, probably a corrupt image fileFailed to open '%s' for writing: %sFailed to open TIFF imageFailed to open file '%s': %sFailed to open temporary fileFailed to read from temporary fileFailed to save TIFF imageFailed to write TIFF dataFailed to write to temporary file when loading XBM imageFailed to write to temporary file when loading XPM imageFailure reading GIF: %sFatal error in PNG image file: %sFatal error reading PNG image fileFatal error reading PNG image file: %sFile does not appear to be a GIF fileGIF file was missing some data (perhaps it was truncated somehow?)GIF image has no global colormap, and a frame inside it has no local colormap.GIF image is corrupt (incorrect LZW compression)GIF image loader cannot understand this image.GIF image was truncated or incomplete.Icon has zero heightIcon has zero widthImage file '%s' contains no dataImage format unknownImage has invalid width and/or heightImage has unsupported bppImage has unsupported number of %d-bit planesImage has zero heightImage has zero widthImage header corruptImage pixel data corruptImage too large to be saved as ICOImage type '%s' is not supportedImage type currently not supportedIncremental loading of image type '%s' is not supportedInsufficient memory to load PNG fileInsufficient memory to load PNM context structInsufficient memory to load PNM fileInsufficient memory to load XBM image fileInsufficient memory to load image, try exiting some applications to free memoryInsufficient memory to open TIFF fileInsufficient memory to save image into a bufferInsufficient memory to save image to callbackInsufficient memory to store a %ld by %ld image; try exiting some applications to reduce memory usageInternal error in the GIF loader (%s)Internal error: Image loader module '%s' failed to complete an operation, but didn't give a reason for the failureInvalid XBM fileInvalid XPM headerInvalid header in animationInvalid header in iconJPEG quality must be a value between 0 and 100; value '%d' is not allowed.JPEG quality must be a value between 0 and 100; value '%s' could not be parsed.Keys for PNG text chunks must be ASCII characters.Keys for PNG text chunks must have at least 1 and at most 79 characters.Malformed chunk in animationMaximum color value in PNM file is 0Maximum color value in PNM file is too largeNo XPM header foundNo palette found at end of PCX dataNot enough memory to composite a frame in GIF fileNot enough memory to load GIF fileNot enough memory to load ICO fileNot enough memory to load RAS imageNot enough memory to load animationNot enough memory to load bitmap imageNot enough memory to load iconNot enough memory to load imagePNG compression level must be a value between 0 and 9; value '%d' is not allowed.PNG compression level must be a value between 0 and 9; value '%s' could not be parsed.PNM file has an image height of 0PNM file has an image width of 0PNM file has an incorrect initial bytePNM file is not in a recognized PNM subformatPNM image loader does not support this PNM subformatPNM loader expected to find an integer, but didn'tPremature end-of-file encounteredRAS image has bogus header dataRAS image has unknown typeRaw PNM formats require exactly one whitespace before sample dataRaw PNM image type is invalidStack overflowTGA image has invalid dimensionsTGA image type not supportedTIFFClose operation failedThe ANI image formatThe BMP image formatThe EMF image formatThe GIF image formatThe ICNS image formatThe ICO image formatThe JPEG 2000 image formatThe JPEG image formatThe PCX image formatThe PNG image formatThe PNM/PBM/PGM/PPM image format familyThe Sun raster image formatThe TIFF image formatThe Targa image formatThe WBMP image formatThe WMF image formatThe XBM image formatThe XPM image formatThis build of gdk-pixbuf does not support saving the image format: %sTopdown BMP images cannot be compressedTransformed JPEG has zero width or height.Transformed JPEG2000 has zero width or heightTransformed PNG has unsupported number of channels, must be 3 or 4.Transformed PNG has zero width or height.Transformed PNG not RGB or RGBA.Unable to load image-loading module: %s: %sUnexpected bitdepth for colormap entriesUnexpected end of PNM image dataUnexpected icon chunk in animationUnrecognized image file formatUnsupported JPEG color space (%s)Unsupported animation typeUnsupported depth for ICO file: %dUnsupported icon typeValue for PNG text chunk %s cannot be converted to ISO-8859-1 encoding.Version %s of the GIF file format is not supportedWidth or height of TIFF image is zeroXPM file has image height <= 0XPM file has image width <= 0XPM file has invalid number of colorsXPM has invalid number of chars per pixelfailed to allocate image buffer of %u bytefailed to allocate image buffer of %u bytesunsupported RAS image variationProject-Id-Version: gtk+ Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=gdk-pixbuf POT-Creation-Date: 2012-02-04 18:44-0500 PO-Revision-Date: 2009-12-24 23:10+0100 Last-Translator: Iestyn Pryce Language-Team: Cymraeg Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n==2) ? 1 : 0; X-Generator: Virtaal 0.5.0 Mae gan y ddelwedd BMP ddata pennawd sothachMae gan y ddelwedd BMP pennawd o faint ni chynhelirCanfuwyd cod gwaelMae nifer y didau i bob sianel y ddelwedd PNG yn annilys.Nid oes 8 did i bob sianel y ddelwedd PNG.Methu dyrannu cof pennawd TGAMethu dyrannu cofnodion map lliwiauMethu dyrannu strwythur map lliwiauMethu dyrannu cof ar gyfer data IOBufferMethu dyrannu cof ar gyfer strwythur IOBufferMethu dyrannu cof ar gyfer strwythur cyd-destun delwedd TGAMethu dyrannu cof er mwyn llwytho delwedd PNMMethu dyrannu cof er mwyn llwytho delwedd XPMMethu dyrannu pixbuf newyddMethu dyrannu data IOBuffer dros droMethu darllen map lliwiau delwedd XPMMethu ail-ddyrannu cof ar gyfer data IOBufferCofnod cylchol mewn tabl ffeil GIFNi chynhelir eiconau wedi eu cywasguMethwyd dyrannu cof: %sMethu creu cyfeiriadur: %sMethu canfod hyd y ddelwedd (ffeil TIFF ddrwg)Methu canfod lled y ddelwedd (ffeil TIFF ddrwg)Methu darllen o'r llif: %sMethwyd dyrannu cof ar gyfer strwythur cyd-destunMethwyd dyrannu cof ar gyfer pennawdMethwyd dyrannu cof ar gyfer data llinellMethu canfod digon o gof er mwyn llwytho'r ffeil JPEGMethu dyrannu digon o gof er mwyn cadw'r ffeil BMPMethwyd dyrannu cof ar gyfer llifMethwyd creu pixbuf newyddMethu canfod fformat delwedd y ffeil '%s'Methu cadw'r gweddillMethu ysgrifennu i'r ffeil BMPMethu ysgrifennu i'r ffeil TIFFMan poeth cyrchydd y tu allan i'r ddelweddNi chafwyd pob llinell delwedd PCXMae dimensiynau'r ddelwedd TIFF yn rhy fawrGwall wrth ddehongli ffeil delwedd JPEG (%s)Gwall wrth ddarllen delwedd ICNS: %sGwall wrth ysgrifennu at ffeil delwedd: %sGwall wrth ysgrifennu at llif delweddGormodedd o ddata mewn ffeilMethu cau '%s' wrth ysgrifennu delwedd, efallai ni arbedwyd yr holl ddata: %sMethu llwytho data RGB o ffeil TIFFMethu llwytho delwedd TIFFMethu llwytho animeiddiad '%s': rheswm anhysbys, ffeil llygredig mwy na thebygMethu llwytho delwedd '%s': %sMethu llwytho delwedd '%s': rheswm anhysbys, ffeil llygredig mwy na thebygMethu agor '%s' er mwyn ysgrifennu: %sMethu agor delwedd TIFFMethu agor y ffeil '%s': %sMethwyd agor ffeil dros droMethwyd darllen o ffeil dros droMethu cadw'r ddelwedd TIFFMethu ysgrifennu'r data TIFFMethu ysgrifennu at ffeil dros dro wrth lwytho delwedd XBMMethu ysgrifennu at ffeil dros dro wrth lwytho delwedd XPMMethiant wrth ddarllen GIF: %sGwall marwol yn y ffeil delwedd PNG: %sGwall marwol wrth ddarllen ffeil delwedd PNGGwall marwol wrth ddarllen ffeil delwedd PNG: %sMae'n ymddangos mai nad ffeil GIF yw'r ffeil hwnRoedd peth data ar goll o'r ffeil GIF (efallai cafodd ei dalfyrru rhywsut?)Doedd dim map lliwiau gan y ddelwedd GIF, ac roedd yn cynnwys ffrâm heb fap lliwiau lleolMae'r ddelwedd GIF yn llygredig (cywasgiad LZW anghywir)Nid yw'r llwythwr delwedd GIF yn deall y ddelwedd hon.Roedd y ddelwedd GIF yn anghyflawn neu wedi gorffen yn rhy fuanMae gan yr eicon hyd seroMae gan yr eicon lled seroFfeil ddelwedd '%s' heb gynnwys dataFformat delwedd anhysbysMae gan y ddelwedd hyd a/neu led annilysMae gan y ddelwedd ddyfnder picsel ni chynhelirMae gan y ddelwedd nifer o blaenau %d did ni chynhelirMae gan y ddelwedd hyd seroMae gan y ddelwedd lled seroPennawd delwedd lygredigMae data picseli'r ddelwedd wedi llygruMae'r ddelwedd yn rhy fawr i gael ei chadw fel ICONi chynhelir y math delwedd '%s'Ni chynhelir y math delwedd ar hyn o brydNi chynhelir llwytho delweddau o'r math '%s' yn gynyddolDim digon o gof er mwyn llwytho'r ffeil delwedd PNGDim digon o gof er mwyn llwytho strwythur cyd-destun delwedd PNMDim digon o gof er mwyn llwytho delwedd PNMDim digon o gof er mwyn llwytho ddeil delwedd XBMDim digon o gof er mwyn llwytho'r ddelwedd, ceisiwch gau rhai rhaglenni er mwyn rhyddhau cofDim digon o gof er mwyn agor ffeil delwedd TIFFDim digon o gof er mwyn cadw delwedd at fyfferDim digon o gof er mwyn cadw delwedd at adalwadDim digon o gof er mwyn llwytho delwedd o faint %ld gan %ld; ceisiwch derfynu rhai rhaglenni er mwyn rhyddhau cofGwall mewnol yn y llwythwr GIF (%s)Gwall mewnol: fe fethodd y modiwl llwytho delweddau '%s' gwblhau'r weithred, ond ni ddarparodd reswm am y methiantFfeil ddelwedd XBM annilysFfeil delwedd XPM annilysPennawd annilys mewn animeiddiadPennawd annilys mewn eiconMae'n rhaid i ansawdd delweddau JPEG fod yn werth rhwng 0 a 100; ni chaniateir y gwerth '%d'.Mae'n rhaid i'r ansawdd JPEG fod yn rhif rhwng 0 a 100; methu adnabod y gwerth '%s'.Dim ond nodau ASCII fedr fod mewn allweddau talp testun delweddau PNG.Mae'n rhaid bod gan allweddau testun delweddau PNG o leiaf un ac o fwyaf 79 o nodau.Darn annilys mewn animeiddiadMae'r gwerth lliw uchaf yn y ffeil delwedd PNM yn seroMae'r gwerth lliw uchaf yn y ffeil delwedd PNM yn rhy fawrNi chanfuwyd pennawd delwedd XPMNi chanfuwyd palet ar ddiwedd data PCXDim digon o gof er mwyn gwneud ffrâm yn gyfansawdd yn y ffeil GIFDim digon o gof er mwyn llwytho ffeil GIFDim digon o gof er mwyn llwytho'r ffeil ICODim digon o gof er mwyn llwytho delwedd RASDim digon o gof er mwyn llwytho animeiddiadDim digon o gof er mwyn llwytho'r ddelwedd didfapDim digon o gof er mwyn llwytho'r eiconDim digon o gof er mwyn llwytho delweddMae'n rhaid i lefel cywasgu'r PNG fod yn rhif rhwng 0 a 9; ni chaniateir y gwerth '%d'.Mae'n rhaid i lefel cywasgu'r PNG fod yn rhif rhwng 0 a 9; methu adnabod y gwerth '%s'.Mae gan y ffeil delwedd PNM hyd seroMae gan y ffeil delwedd PNM lled seroMae gan y ffeil delwedd PNM feit dechreuol annilysNid yw'r ffeil delwedd PNM mewn is-ffurf PNM a adnabyddirNid yw'r llwythwr delweddau PNM yn cynnal y fformat PNM ymaRoedd y llwythwr PNM yn disgwyl cyfanrif, ond chafwyd ddimCanfuwyd diwedd ffeil yn rhy fuanMae gan y ddelwedd RAS ddata pennawd annilysMae gan y ddelwedd RAS fath anhysbysMae fformatau PNM crai yn mynnu un nod gofod yn union cyn data samplauMae math y ddelwedd PNG crau yn annilysGorlifodd y stacMae gan y ddelwedd TGA ddimensiynau annilysNi chynhelir math y ddelwedd TGAMethodd y weithred TIFFCloseY fformat delwedd ANIY fformat delwedd BMPY fformat delwedd EMFY fformat delwedd GIFY fformat delwedd ICNSY fformat delwedd ICOY fformat delwedd JPEG 2000Y fformat delwedd JPEGY fformat delwedd PCXY fformat delwedd PNGY teulu fformatau delwedd PNM/PBM/PGM/PPMFformat delwedd raster SunY fformat delwedd TIFFY fformat delwedd TargaY fformat delwedd WBMPY fformat delwedd WMFY fformat delwedd XBMY fformat delwedd XPMNid yw'r gosodiad yma o gdk-pixbuf yn cynnal cadw'r fformat delwedd: %sNi ellir cywasgu delweddau BMP top-i'r-gwaelodMae gan y ddelwedd JPEG drawsffurfedig hyd neu led o sero.Mae gan y ddelwedd JPEG2000 drawsffurfedig hyd neu led o sero.Mae gan y ddelwedd PNG drawsffurfedig nifer o sianeli na chynhelir, rhaid bod 3 neu 4 sianel.Mae gan y ddelwedd PNG drawsffurfedig hyd neu led sero.Nid yw'r ddelwedd PNG yn y ffurf RGB neu RGBA.Methu llwytho modiwl llwytho delweddau: %s: %sDid-ddyfnder annisgwyl ar gyfer cofnodion map lliwiauDiwedd annisgwyl i ddata delwedd PNMDarn eicon annisgwyl mewn animeiddiadFformat delwedd anhysbysGofod lliw JPEG ni chynhelir (%s)Math animeiddiad ni chynhelirDyfnder ni chynhelir ar gyfer ffeil ICO: %dMath eicon ni chynhelirNi allwyd trawsffurfio gwerth testun delwedd PNG %s i amgodiad ISO-8859-1.Ni chynhelir fersiwn %s y fformat delwedd GIFMae hyd neu led y ddelwedd TIFF yn seroMae gan y ffeil delwedd XPM hyd <= 0Mae gan y ffeil delwedd XPM lled <= 0Mae gan y ffeil delwedd XPM nifer annilys o liwiauMae gan y ddelwedd XPM nifer annilys o feitiau i bob picselmethu creu byffer delwedd %u beitmethu creu byffer delwedd %u feitamrywiad delwedd RAS ni chynhelirLC_MESSAGES/policycoreutils.mo000064400000001041152343356400012120 0ustar00,<P Q[ Password:Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2023-02-15 12:35+0100 PO-Revision-Date: 2016-06-17 05:40-0400 Last-Translator: Copied by Zanata Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural= (n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3 X-Generator: Zanata 4.6.2 Cyfrinair:LC_MESSAGES/atk10.mo000064400000017721152343356400007623 0ustar00        0 I #i     C W -a 4 ?S : < 7 4C,x$B 5- c'o#"(=6E*|      . < F Q _lqx      %+?NV \in s}           - 7B H S_ gq x      (1N8   &GeU117cA1>s?<8/1h&Z-3>r$*=4R,     4A P\m     (1 8ELTdjr    - 3=N V b o{       %/CU nx     s c@wDLXl`V(Ef,P#dvSWQj5N OTIx)1R$? qFe/[3"izA\tuh6rMgn- *o_9=.^<J]GC48 B +Y0;%{b'2pKZy:!}7ka&>Hm~|UAccessible DescriptionAccessible LayerAccessible MDI ValueAccessible NameAccessible ParentAccessible RoleAccessible Table CaptionAccessible Table Caption ObjectAccessible Table Column DescriptionAccessible Table Column HeaderAccessible Table Row DescriptionAccessible Table Row HeaderAccessible Table SummaryAccessible ValueDescription of an object, formatted for assistive technology accessEnd indexIs used to notify that the parent has changedIs used to notify that the table caption has changedIs used to notify that the table caption has changed; this property should not be used. accessible-table-caption-object should be used insteadIs used to notify that the table column description has changedIs used to notify that the table column header has changedIs used to notify that the table row description has changedIs used to notify that the table row header has changedIs used to notify that the table summary has changedIs used to notify that the value has changedNumber of Accessible Hypertext LinksNumber of AnchorsObject instance’s name formatted for assistive technology accessSelected LinkSpecifies whether the AtkHyperlink object is selectedStart indexThe accessible MDI value of this objectThe accessible layer of this objectThe accessible role of this objectThe end index of the AtkHyperlink objectThe number of anchors associated with the AtkHyperlink objectThe number of links which the current AtkHypertext hasThe start index of the AtkHyperlink objectaccelerator labelalertanimationapplicationarrowautocompletecalendarcanvascaptionchartcheck boxcheck menu itemcolor choosercolumn headercombo boxdateeditordesktop framedesktop icondialdialogdirectory panedocument framedrawing areaedit barembedded componententryfile chooserfillerfontchooserfooterformframeglass paneheaderheadinghtml containericonimageinput method windowinternal frameinvalidlabellayered panelinklistlist itemmenumenu barmenu itemoption panepagepage tabpage tab listpanelparagraphpassword textpopup menuprogress barpush buttonradio buttonradio menu itemredundant objectroot panerow headerrulerscroll barscroll panesectionseparatorsliderspin buttonsplit panestatusbartabletable celltable column headertable row headertear off menu itemterminaltexttoggle buttontool bartool tiptreetree tableunknownviewportwindowProject-Id-Version: atk Report-Msgid-Bugs-To: POT-Creation-Date: 2009-12-21 15:05+0800 PO-Revision-Date: 2009-07-30 21:50+0100 Last-Translator: Iestyn Pryce Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Disgrifiad HygyrcholHaen HygyrcholGwerth MDI HygyrcholEnw HygyrcholRhiant HygyrcholRôl HygyrcholCapsiwn Tabl HygyrcholGwrthrych Capsiwn Tabl HygyrcholDisgrifiad Colofn Tabl HygyrcholPennawd Colofn Tabl HygyrcholDisgrifiad Rhes Tabl HygyrcholPennawd Rhes Tabl HygyrcholCrynodeb Tabl HygyrcholGwerth HygyrcholDisgrifiad gwrthrych, wedi ei fformadu er mwyn ei ddefnyddio gyda technoleg hygyrcholRhif mynegai olafDefnyddir er mwyn hysbysu fod y rhiant wedi newidDefnyddir er mwyn hysbysu fod capsiwn y tabl wedi newidDefnyddir er mwyn hysbysu fod capsiwn y tabl wedi newid; ni ddylid defnyddio'r nodwedd hon. Dylid defnyddio accessible-table-caption-object yn ei lleDefnyddir er mwyn hysbysu fod disgrifiad colofn y tabl wedi newidDefnyddir er mwyn hysbysu fod pennawd colofn y tabl wedi newidDefnyddir er mwyn hysbysu fod disgrifiad rhes y tabl wedi newidDefnyddir er mwyn hysbysu fod pennawd rhes y tabl wedi newidDefnyddir er mwyn hysbysu fod crynodeb y tabl wedi newidDefnyddir er mwyn hysbysu fod y gwerth wedi newidNifer Cysylltion y Gordestun HygyrcholNifer yr AngorauEnw'r enghraifft gwrthrych wedi ei fformadu er mwyn ei ddefnyddio gyda technoleg hygyrcholDolen DdewisedigPenodi a yw'r gwrthrych AtkHyperlink wedi ei ddewisRhif mynegai cyntafGwerth MDI Hygyrchol y gwrthrych hwnHaen hygyrchol y gwrthrych hwnRôl hygyrchol y gwrthrych hwnRhif mynegai olaf y gwrthrych AtkHyperlinkNifer yr angorau sy'n gysylltiedig a'r gwrthrych AtkHyperlinkNifer y cysylltion sydd gan yr AtkHypertext cyfredolRhif mynegai cyntaf y gwrthrych AtkHyperlinklabel cyflymurhybuddanimeiddiadrhaglensaethcwblhad awtomatigcalendrcynfascapsiwnsiartblwch dewiseitem dewislen dewisdewiswr lliwpennawd colofnblwch cyfunnewidydd dyddiadffrâm bwrdd gwaitheicon bwrdd gwaithdeialdeialogchwarel cyfeiriadurffrâm ddogfenardal arluniobar golygucydran mewnosodiedcofnoddewiswr ffeiliaullenwydddewiswr ffonttroedynffurflenffrâmchwarel-wydrpenawdpennawdcynhwysydd htmleicondelweddffenest modd mewnbwnffrâm fewnolannilyslabelchwarel wedi haenucyswlltrhestreitem rhestrdewislenbar dewisleneitem dewislenchwarel opsiwntudalentab tudalenrhestr tab tudalenpanelparagrafftestun cyfrinairnaidlenbar cynnyddbotwm gwasgubotwm radioeitem dewislen radiogwrthrych diangenchwarel gwraiddpennawd rhesmesurbar sgroliochwarel sgrolioadrangwahanwrllithrwrbotwm troellichwarel holltbar-statwstablcell tablpennawd colofn tablpennawd rhes tableitem dewislen rhwygadwyterfynelltestunbotwm toglbar offercyngor offercoedentabl coedenanhysbysporth-golwgffenestLC_MESSAGES/selinux-python.mo000064400000001751152343356400011705 0ustar00 h iv} |       ApplicationsCancelDefaultEnabledLanguageNameNoRetryStateSystemTypeYesoffonProject-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2023-02-15 12:35+0100 PO-Revision-Date: 2016-06-17 05:40-0400 Last-Translator: Copied by Zanata Language-Team: Welsh Language: cy MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=4; plural= (n==1) ? 0 : (n==2) ? 1 : (n != 8 && n != 11) ? 2 : 3 X-Generator: Zanata 4.6.2 CymwysiadauDiddymuRhagosodynGalluogIaithNameNaAil-geisioStateSystemMathÏewedi'i ddiffoddynghyn